KEGG   Flavobacterium anhuiense: BB050_04284Help
Entry
BB050_04284       CDS       T04718                                 

Definition
(GenBank) Putative reductase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
fjg  Flavobacterium anhuiense
Pathway
fjg00061  Fatty acid biosynthesis
fjg00650  Butanoate metabolism
fjg01100  Metabolic pathways
fjg01120  Microbial metabolism in diverse environments
fjg01200  Carbon metabolism
fjg01212  Fatty acid metabolism
Module
fjg_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:fjg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BB050_04284
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BB050_04284
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fjg01004]
    BB050_04284
Enzymes [BR:fjg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     BB050_04284
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     BB050_04284
Lipid biosynthesis proteins [BR:fjg01004]
 Fatty acid synthase
  Component type
   BB050_04284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: AOC97362
UniProt: A0A1G5GTU8
Position
complement(5025643..5026833)
Genome map
AA seq 396 aa AA seqDB search
MIIEPRMRGFICLTAHPTGAEQNVKNQIEYVKSKGEIAGAKKVLVIGASTGFGLASRITS
AFGSGASTIGVFFEKPPVEGKTASPGWYNSAAFEKEAHKAGLYAKSINGDAFSNEIKRET
LDLIKADLGQVDLVIYSLASPVRTNPNTGVTHRSVLKPIGQTFTNKTVDFHTGKVSDVSI
APANEEDIENTVAVMGGEDWAMWIEALKAENLLAEGATTVAYSYIGPALTEAVYRKGTIG
RAKDHLEATAFTIGDSLKSIGGKAYVSVNKALVTQASSAIPVIPLYISLLYKIMKEEGIH
EGCIEQIQRLFQDRLYTGSEVPVDEKGRIRIDDWEMREDVQEKVAKLWLEATTETLPEIG
DLAGYRNDFLNLFGFEVPGVDYNADTNEVVEIESIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgattatagaacctagaatgagaggatttatttgtttgactgcccacccaactggagct
gaacaaaatgtaaaaaatcaaattgaatacgtaaaatctaaaggagaaattgctggagct
aaaaaagttttagtaattggtgcttctacaggtttcggattagcttcaagaattactagt
gcttttggttctggtgcatcaacaattggagtgtttttcgaaaaaccgccagttgaagga
aaaactgcttctccaggatggtataattctgcagcatttgaaaaagaggctcataaagca
ggtttatatgcaaaaagtattaatggagatgccttctcaaacgaaattaagagagaaact
ctcgatttaattaaagcagatttaggtcaggtagatcttgtgatttatagtttagcttct
ccagtgcgtacaaatccaaatacaggcgttacgcaccgttcagttttaaaaccaattgga
cagacgtttacaaataaaacagttgatttccacacaggaaaagtttcagatgtttctatt
gctcctgcaaatgaggaagatattgaaaatacagttgctgttatgggtggagaagactgg
gcaatgtggattgaagctttaaaagctgaaaatttattagctgaaggagctacaacagtt
gcttattcttatattggtccagcattgactgaagcagtttaccgtaaaggcacaatcggg
cgtgctaaagatcatttagaggctactgcatttactatcggtgattctttaaaatctatt
ggaggaaaagcgtatgtttctgtaaacaaagctttggttacacaagcaagttctgcaatt
ccagtaattccgttatatatttctcttttatataaaatcatgaaagaagaaggaattcac
gaaggttgtatcgagcaaattcagcgtttattccaagatagattatacactggttctgaa
gttcctgttgatgaaaaaggaagaatcagaattgatgattgggaaatgcgtgaagatgtt
caggaaaaagtggctaaactttggttagaagcaacaactgaaacattgccagaaattggt
gatttagcaggatacagaaatgatttcttaaacttattcggatttgaagttcctggtgtt
gattataacgcagatactaacgaagttgttgagatagaaagcatcaaataa

DBGET integrated database retrieval system