KEGG   Flavobacterium johnsoniae UW101: Fjoh_0839Help
Entry
Fjoh_0839         CDS       T00508                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00260  Glycine, serine and threonine metabolism
fjo00680  Methane metabolism
fjo01100  Metabolic pathways
fjo01120  Microbial metabolism in diverse environments
fjo01130  Biosynthesis of antibiotics
fjo01200  Carbon metabolism
fjo01230  Biosynthesis of amino acids
Module
fjo_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Fjoh_0839
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fjoh_0839
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fjo04147]
    Fjoh_0839
Enzymes [BR:fjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     Fjoh_0839
    1.1.1.399  2-oxoglutarate reductase
     Fjoh_0839
Exosome [BR:fjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fjoh_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN NAD_binding_2 F420_oxidored SYCE1 AdoHcyase_NAD 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABQ03873
UniProt: A5FLN9
Position
complement(949735..950679)
Genome map
AA seq 314 aa AA seqDB search
MSVKILHIDSNHPVLWNQLEEAGFENHADFKSSKEEIEAKIQDYNGIVIRSRFKIDKTFL
DKAVNLQFIARVGAGLESIDCDYAETKGIRLIAAPEGNRNAVAEHSLGVILSLFNNLNQA
DAEVKAGQWNRESNRGHELDLKTVGIIGYGNMGKAFAKKLRGFETEVLCYDILDNVGDEN
ARQVSLAELQEKTDVLSLHLPWTPETDKMVNTDFINAFKKPFWIINTSRGKNIVTADLVE
AMKIKKILGAGLDVLEYEKLSFETLFQDKNTPEAFQYLLEAKNVLLTPHIAGWTFESHER
LAQVIVDKIKAVYA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtaaaaattctacatatagacagcaaccatccggttctgtggaaccagttagaa
gaagcaggttttgaaaaccatgccgattttaaatcttctaaagaagaaattgaagctaaa
attcaggattataatggtattgtaattcgaagccgatttaaaattgataagactttttta
gataaagccgtaaatcttcagtttatcgccagagttggtgcaggtttagaaagtattgac
tgtgattatgccgaaacaaaaggaattcgtttaattgctgcgcccgaaggaaaccgaaat
gcagttgctgaacattcgcttggcgtaatcttatcgctttttaataatttaaatcaggcc
gatgccgaagtgaaagccggacaatggaatcgcgaaagtaaccgcggccacgaactggac
ttaaaaacggtaggtattattggttacggaaatatgggaaaggcttttgctaaaaaactt
cgcggttttgaaacagaagttttgtgttatgatattctggataatgttggcgatgaaaat
gccagacaagtttctctggcagaattacaagaaaaaacagatgttttgagtcttcacctt
ccgtggacaccagaaacagacaaaatggttaacaccgattttataaatgcctttaaaaag
ccgttttggatcattaatacttcacgaggcaaaaacattgttacggcagatttagtcgaa
gcaatgaagataaaaaaaatattaggagcagggctggatgttcttgagtatgaaaaacta
tcttttgaaacactttttcaggataaaaatacaccggaagcatttcaatatctgcttgaa
gcaaaaaatgttttgctgacgccgcatattgcaggctggacattcgaaagtcatgagcgt
ctggctcaggttattgtagataaaattaaggctgtatatgcctag

DBGET integrated database retrieval system