KEGG   Flavobacterium johnsoniae UW101: Fjoh_1909Help
Entry
Fjoh_1909         CDS       T00508                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
Organism
fjo  Flavobacterium johnsoniae UW101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ABQ04941
UniProt: A5FIN4
Position
complement(2209515..2210492)
Genome map
AA seq 325 aa AA seqDB search
MNVFINKNIPEAGLRLLQEKGINLTINPTENVLSREDFIKICQKNDVLLNVGTQNFFDED
FFQQCPNLKGIALFSVGFDSVNIPSANSRKIPIGNTPDVLSRATSDVSFLLMQSVARKSF
FNHKRILNNDWGSFDPLANLGQELYGKTLGIFGLGRIGFKMAQKCKAAFGMNIIYHNRSR
KEDAEKELDAKYVDFETLLAESDVLSIHANYSAENNEIFNKNAFAKMKSNSIFINTARGK
FHNENDLFEALTNNIIWGAGLDVTNPEPMKQDNPLLSLANCCVLPHIGSATYEARNGMAV
CAAQNVIAVIEGKKMPFCVNEEVYS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtttttatcaataaaaatataccagaagctggtcttagattacttcaggaaaaa
ggcataaatctgactataaacccaacagaaaatgtattatccagagaagattttattaaa
atctgccagaaaaacgatgttcttttaaatgttggaacccaaaacttttttgatgaagat
ttttttcagcaatgtcccaatttaaaaggcattgctttgttttctgtgggatttgattct
gtcaatattccatcggcaaacagcagaaaaattcctattgggaatacacccgatgtttta
agcagagcgacatctgatgtttcctttttattgatgcaaagcgttgcgagaaaatcattt
ttcaatcataaaagaattttaaacaacgattggggaagttttgatccgttagccaattta
gggcaggaactatatggcaaaacattaggaatatttggattgggacgaattggttttaaa
atggctcaaaaatgcaaagccgcatttggaatgaacattatttaccataatcgttcccgt
aaagaagatgcagaaaaagaattggatgctaagtatgtagattttgaaaccttacttgca
gaaagcgatgttttaagcattcatgctaattacagtgcagaaaacaatgaaattttcaat
aaaaatgcttttgctaaaatgaaatcgaattcgattttcatcaataccgcaagagggaaa
tttcataatgaaaatgatttgtttgaggcactgactaataatataatctggggcgctgga
ttagacgttaccaatccagaaccaatgaaacaagataatccgttattgtcgcttgcaaat
tgctgcgttttaccgcacattggctcagcaacatacgaagcccgaaacggaatggcagtt
tgtgcagcgcaaaatgtaattgcggttattgaaggcaaaaaaatgccgttttgtgttaat
gaggaagtttattcttaa

DBGET integrated database retrieval system