KEGG   Flavobacterium johnsoniae UW101: Fjoh_1914Help
Entry
Fjoh_1914         CDS       T00508                                 

Definition
(GenBank) aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00860  Porphyrin and chlorophyll metabolism
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fjoh_1914
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fjo01007]
    Fjoh_1914
Enzymes [BR:fjo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     Fjoh_1914
Amino acid related enzymes [BR:fjo01007]
 Aminotransferase (transaminase)
  Class III
   Fjoh_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABQ04946
UniProt: A5FIM3
Position
2213071..2214357
Genome map
AA seq 428 aa AA seqDB search
MLYKRSSQLFAEAEKVIPGGVNSPVRAFKAVGGTPIFVKSAKGAYLYDEDGNKLIDYINS
WGPMVLGHAYQPVVDAVIEKAKLGTSFGMPTELETEIAALAVSMVPNIDKIRFVNSGTEA
CMSAIRLARGFTKRDKIIKFAGCYHGHSDSFLIQAGSGAVTFGSPNSPGVTEGTAKDTLL
AKYNDLENVKTLIEANKGEIAAIIIEAVAGNMGCIPPAEGFLQGLRDLCTANGILLIFDE
VMTGFRLARGGVQELYGIDADIVTFGKVIGGGLPVGAFAAREEIMNYLAPLGPVYQAGTL
SGNPLAMAAGYAMLKALDNDREIFTRLEEKTAYLEAGIDRVLKANNVVFTINRVGSMISV
HFDAGPVTDFKTAAKGDNETFKKFFHGLLQEGVYIAPSAYETWFITDALTYEDLDFTINA
IDKVSKTF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttatataaaagaagtagtcagctttttgctgaagcagaaaaagtaattccgggagga
gtaaattcaccagtaagagcctttaaagcagttggcggaactccgatttttgtaaaaagt
gctaaaggcgcttatttatatgatgaagacggaaacaaattaatagattacatcaactct
tggggaccaatggttttaggccacgcttatcagccggttgttgatgctgtaatcgaaaaa
gcaaaactgggtacttcatttggaatgccgacagaattggaaacagaaatcgctgcttta
gccgtttctatggttccaaatattgacaaaatacgttttgtaaattcgggtacagaagct
tgtatgagcgcaattcgtctggctcgcggatttacaaaaagagataaaatcatcaaattt
gcaggttgctatcacggacattctgattcattcctgattcaggcaggaagcggtgcggta
acttttggatctccaaatagtccaggggttacagaaggaactgcaaaagatactttatta
gcgaaatacaatgatttagagaatgtaaaaactttaatcgaagctaacaaaggggaaatt
gccgctatcattattgaagctgttgctggaaatatgggttgtattccaccagcagaaggt
ttcttgcaaggtttaagagacttatgtacagcaaacggaattttattgatttttgatgag
gtaatgactggtttccgtttagcacgcggcggagttcaggaattatatggaattgatgct
gatattgtgactttcggaaaagttattggcggcggacttcctgttggagcttttgcagca
cgcgaagaaatcatgaattatttagctcctcttggaccagtttatcaggcaggaacatta
tctggaaatccgttagcaatggctgcaggatatgcgatgttaaaagctcttgataatgac
agagaaatttttactcgtttagaagaaaaaacagcatatttagaagcaggaattgacaga
gttttaaaagcaaacaatgttgtgtttacaatcaatagagtcggttctatgatttcagtt
cactttgatgcaggtccggtgacagattttaaaactgctgcaaaaggagataacgaaacg
tttaagaaattcttccacggattgctgcaggaaggtgtatacattgcgccatctgcatat
gaaacatggtttattacagatgctttaacgtatgaagatttagattttacaattaatgcg
atcgacaaggtttcgaaaacattttaa

DBGET integrated database retrieval system