KEGG   Flavobacterium johnsoniae UW101: Fjoh_1917
Entry
Fjoh_1917         CDS       T00508                                 

Definition
(GenBank) D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
  KO
K03778  D-lactate dehydrogenase [EC:1.1.1.28]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00620  Pyruvate metabolism
fjo01100  Metabolic pathways
fjo01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fjoh_1917
Enzymes [BR:fjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.28  D-lactate dehydrogenase
     Fjoh_1917
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 IlvN AdoHcyase_NAD 3HCDH_N F420_oxidored
Other DBs
NCBI-ProteinID: ABQ04949
UniProt: A5FIM6
Position
2215912..2216913
AA seq 333 aa
MSKIAFFSTQPYDKAFFNKYNADFGFELDFFETQLNPQTVILIENAEIVCVFVNDIVNET
VIKQLAEKNVKIIALRCAGFNNVDLDAAKKYCLKVCRVPAYSPQAVAEHAMAMILTLNRK
THKAYNRVREQNFSLNGLLGFDLFGKTIGIIGTGNIGKAFSKIALGFGCKVLAYDIVENE
EMKKEGVSFVGLEEIFKSSDIISLHCPLNDQTKHVINKTSISFMKDNVMIINTSRGGLIE
TSSVIEGLKEGKIGYLGIDVYEQEEKLFFRDLSADIIQDDAIQRLMSFPNVLVTAHQAFF
TNEALTQIALVTFNNIKSLLEKNDIENKTALLV
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagcaaaatcgcctttttctcaacgcagccttacgacaaagctttctttaacaaatac
aatgctgactttggttttgaattagattttttcgaaacacaattgaatccgcagactgta
attttaattgaaaatgctgaaattgtctgtgttttcgtaaatgatattgtaaacgaaaca
gtaataaaacaattggcagaaaaaaatgtaaaaattattgcattgcgatgtgcgggtttt
aataatgttgatctggatgctgcaaaaaagtactgccttaaagtctgccgtgttcctgca
tattctccacaagccgttgcagaacatgcaatggccatgattttgactttaaacagaaaa
acacataaagcttataacagagttcgcgaacagaatttttctctaaacggattattgggg
tttgatttgtttggaaagacaattggaattattggaacaggaaatataggaaaagcattt
tctaaaattgctcttggttttggctgtaaagttttggcttatgatattgttgaaaatgaa
gaaatgaaaaaggaaggcgtatcttttgttggtttagaggagatttttaaatcaagtgat
attatttcgcttcactgcccattaaacgatcagacgaagcatgtgattaataagacttcg
atttcttttatgaaagataatgtaatgattatcaatacaagccgcggcggattaatagaa
acttcgagtgtaattgaaggtttaaaagaaggtaaaataggttatttagggattgatgtt
tacgaacaggaagaaaaactgttctttagagatttatcagcagatattattcaggatgat
gcaattcagcgtttaatgagttttccaaatgttttggtaacggcgcatcaggcatttttt
actaatgaagctttaacccagatcgctttggtgacttttaataatataaaatcattgctg
gagaaaaacgatattgaaaataaaacagctctgctggtttaa

DBGET integrated database retrieval system