KEGG   Flavobacterium johnsoniae UW101: Fjoh_2162Help
Entry
Fjoh_2162         CDS       T00508                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00020  Citrate cycle (TCA cycle)
fjo00640  Propanoate metabolism
fjo00660  C5-Branched dibasic acid metabolism
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01120  Microbial metabolism in diverse environments
fjo01130  Biosynthesis of antibiotics
fjo01200  Carbon metabolism
Module
fjo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fjo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fjoh_2162
   00640 Propanoate metabolism
    Fjoh_2162
   00660 C5-Branched dibasic acid metabolism
    Fjoh_2162
Enzymes [BR:fjo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Fjoh_2162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 DUF2711 PGM_PMM_III
Motif
Other DBs
NCBI-ProteinID: ABQ05190
UniProt: A5FHX8
Position
2618512..2619705
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQGKEILASYGVRVQRGIVANNAVEAVAAAKQLTAETGTGWHVIKAQIHAGGRGK
GGGVKLAKNLQQVEELAEQIIGMQLITPQTPPEGKKVNKVLVAEDVYYPGESETSEFYVS
VLLNRGTGRNMIMYSTEGGMDIEEVAEHTPHLIFTEEIDPTVGLQGFQARRIAFNLGLSG
NAFKEMVKFIDALYNAYIGSDASMFEINPVLKTSDNKILAVDAKVNIDDNALYRQPKYAE
MRDIREENPIEVEAKEVGLNYVDLDGTVGCMVNGAGLAMATMDLIKYAGFEPANFLDVGG
TADAKRVETAFRIILKDPNVKAILINIFGGIVRCDRVAQGVVDAYKNMGDAIKVPIIVRL
QGTNAEIAKELIDNSGMPILSAVQFQEAADQVKAALS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacatacacgaatatcaaggaaaagaaattttagcgagttacggagtacgcgtacaa
cgcggaattgtggctaacaatgcggttgaagctgtagctgctgcaaaacaattaactgcc
gaaactggtacaggatggcatgtaataaaagcacaaattcacgcaggtggtcgtggaaaa
ggtggtggagttaagctggcaaaaaacttacaacaagttgaagagttagcagaacaaatc
atcggaatgcagttgattacacctcagactccgcctgaaggtaaaaaagtaaataaggta
ttagttgcagaagatgtttactatccaggtgaaagcgaaacttctgaattttatgtttct
gttttattgaatagaggtacaggacgcaacatgattatgtattctactgaaggtggaatg
gatatcgaagaagttgctgagcatactccacacttaatctttactgaagaaattgatcca
actgttggattacaaggtttccaggctagaagaattgcttttaacttaggactttctgga
aatgctttcaaagaaatggttaaattcatcgacgcactttacaatgcttacattggttct
gatgcttctatgtttgaaatcaacccagttttaaaaacttctgataacaaaatcttagcg
gttgatgctaaagttaacatcgacgataacgctttatacagacaacctaaatatgctgaa
atgagagatatccgtgaggagaatccaatcgaagttgaagctaaagaagttggtctaaac
tatgttgaccttgacggtactgtaggatgtatggtaaacggagctggtcttgcaatggca
actatggatttaattaaatatgctggttttgagcctgctaacttccttgacgtaggagga
actgctgatgcaaaacgtgttgaaacagctttcagaattatcttgaaagatccaaacgta
aaagctatcttaattaacatcttcggaggtattgttcgttgtgaccgtgttgctcaaggt
gttgttgacgcttacaaaaacatgggagacgctattaaagtgccaattatcgttcgtttg
caaggaacaaatgctgaaattgcaaaagaattaattgacaactctggtatgccaatctta
tctgcagttcaattccaagaagctgctgaccaagttaaagctgctctttcttaa

DBGET integrated database retrieval system