KEGG   Flavobacterium johnsoniae UW101: Fjoh_2181Help
Entry
Fjoh_2181         CDS       T00508                                 

Definition
(GenBank) isocitrate dehydrogenase, NADP-dependent
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00020  Citrate cycle (TCA cycle)
fjo00480  Glutathione metabolism
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01120  Microbial metabolism in diverse environments
fjo01130  Biosynthesis of antibiotics
fjo01200  Carbon metabolism
fjo01210  2-Oxocarboxylic acid metabolism
fjo01230  Biosynthesis of amino acids
Module
fjo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fjo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fjoh_2181
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Fjoh_2181
Enzymes [BR:fjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Fjoh_2181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF1843
Motif
Other DBs
NCBI-ProteinID: ABQ05209
UniProt: A5FHV4
Position
complement(2637604..2639826)
Genome map
AA seq 740 aa AA seqDB search
MTQNSKIFYTLTDEAPLLATYSLLPIVQAFTSTAGIAIETRDISLAGRILSNFPESLTDA
QKTGDALAELGQLATQPEANIIKLPNISASVPQLKAAIAELQSHGYNVPNYPEDPQNDSE
KEIKAKYAKVLGSAVNPVLREGNSDRRAPRAVKNFAKANPHSMGAWSADSKTKVASMSNG
DFYGSEKSLTVNDANDVKIEFVAKDGTTTVLKASTPLKAGEIIDSSVLSVNKLKAFAADV
IAEAKAAGVLLSVHLKATMMKVSDPIIFGAIVEVYFADVFKKYASLFAELNVDTRNGLGD
IYAKIAGRPEQAEVEAAIDQAIADGPALAMVNSDKGITNLHVPSDVIVDASMPAMIRTSG
QMWNKEGKAQDTFAVIPDRSYAGVYTATIDFCKKHGAFDPKTMGSVPNVGLMAQKAEEYG
SHDKTFQIKGDGVVRVVDQNGNVLMEQNVEANDIFRMCQAKDAPIQDWVKLAVNRARLSD
TPAVFWLDENRAHDRELIVKVQKYLKDYDTTNLDIRILNPIAATEFTLDRIIKGLDTISV
TGNVLRDYLTDLFPILELGTSAKMLSIVPLMNGGGLFETGAGGSAPKHVEQFTEEGYLRW
DSLGEFLALGASLEHLGQTLDNSKAIVLSETLDQANDKFLANDKSPARKVGQIDNRGSHF
YLAFYWAQALAAQDKDAELKAIFTPIAAEFEANEAKIDAELIAAQGKAQNIGGYYQPTPE
LVSKAMRPSETFNAIIAKIK
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgacacagaattcaaaaattttttacaccttaactgatgaggcgccattattagcgact
tattctttattacctattgtccaagcttttacttctacagctggtattgctattgaaact
agagacatctctttggcaggaagaattttatctaatttccctgaatctttaacagatgct
caaaaaacaggagatgctcttgcagaacttggccaattagcaactcagccagaagctaac
attattaaattaccaaacatttcagcatctgtaccgcaattaaaagcggctattgctgaa
ttacaatcacatggttataatgttcctaattacccggaagatccacaaaacgattctgaa
aaggaaattaaagcaaaatatgcaaaagtattaggttctgcagtaaaccctgttttacgc
gaaggtaactcagatcgtagagcgccaagagccgttaaaaactttgcaaaagcaaatcca
cactcaatgggtgcatggtctgctgactcaaaaacaaaggtagcttctatgtcaaacggt
gatttctatggaagcgaaaaatcactaactgtaaatgacgctaatgatgtaaaaattgaa
tttgttgctaaagacggaactacaactgttttaaaagcaagtactccgctaaaagcaggt
gaaattattgacagctcagttttaagtgtaaataaattaaaagcttttgctgcagatgta
atcgctgaggctaaagctgcaggagttttactttctgtacacttaaaagctacaatgatg
aaagtttctgatccaattatctttggcgctatcgttgaagtatattttgcagatgttttc
aaaaaatacgcttctttatttgctgaattaaacgttgatacaagaaacggtttaggcgat
atctacgctaaaattgccggaagaccagagcaggcagaagttgaagctgctatcgatcag
gcaatcgctgacggaccagctttagcaatggttaattctgataaaggaattacaaactta
cacgttccatctgacgtaattgttgatgcttctatgccggcaatgattcgtacttctgga
caaatgtggaacaaagaaggtaaagcacaagatacattcgctgttattccagacagatct
tatgctggtgtttatactgcaactatcgatttctgtaaaaaacacggtgcttttgaccca
aaaacaatgggaagtgttcctaacgttggattaatggctcaaaaagcagaagaatacgga
tctcacgacaaaactttccaaattaaaggagatggtgttgtacgtgtggttgaccaaaac
ggaaatgttttaatggaacaaaacgttgaagcaaacgatattttcagaatgtgtcaggca
aaagacgctcctattcaggactgggttaaattggctgtaaacagagctcgtttatctgat
actcctgctgttttctggttagacgaaaacagagcacacgatagagaattgatcgtaaaa
gttcaaaaataccttaaagactacgatactacaaacttagatatccgtattttaaaccca
attgctgctacagaatttactttagacagaatcatcaaaggtttagatacaatttctgta
actggaaacgttttacgtgactatttaacagatttattcccaattttagaattaggaact
tctgcaaaaatgttatctatcgttcctttaatgaacggtggcggattgtttgaaactggt
gctggaggatctgctccaaaacacgttgagcaatttacagaagaaggatacttacgttgg
gattctcttggagaatttttagctcttggtgcttcattagagcatttaggacaaacttta
gacaattctaaagcaattgttttatctgaaactttagatcaggcaaacgataaattctta
gcaaacgataaatctccagctcgtaaagttggtcagattgataaccgtggatctcacttt
tatttagcattctactgggctcaggctttagctgctcaggacaaagatgctgaattgaaa
gcgatctttactccaattgctgctgaatttgaagcaaacgaagctaaaatcgatgctgaa
ttaattgctgcacaaggaaaagctcaaaacattggcggttattatcagccaactcctgag
ttagtaagcaaagcaatgcgtcctagtgaaacattcaatgctattattgctaaaatcaaa
taa

DBGET integrated database retrieval system