KEGG   Flavobacterium johnsoniae UW101: Fjoh_2403Help
Entry
Fjoh_2403         CDS       T00508                                 

Definition
(GenBank) non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Fjoh_2403
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     Fjoh_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ABQ05430
UniProt: A5FH89
Position
complement(2877552..2878130)
Genome map
AA seq 192 aa AA seqDB search
MKLVFASNNKNKIAEIQSMLPESITILSLEDINCFEDIPETADTIEGNAILKADYVTQKY
GYDCFADDTGLEVDAINGEPGVYSARYAGEQKNADDNMNKLLKALENNKNRSAQFKTVIT
LNLEGKQYIFTGIAKGEITETKTGTNGFGYDPIFKPENFDKTFAELPLEIKNTIGHRGKA
VQQLIDLLTATK
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgttttcgcttcaaacaacaaaaataaaattgcagaaatacaaagcatgctt
cctgaaagtattacaatattaagtttagaagatattaattgttttgaagatattcctgaa
actgcagatacaattgaaggaaatgccattttgaaagcggattacgtaacacaaaagtat
ggttacgattgttttgcagatgatactggactggaagtagatgctataaatggagaaccc
ggagtgtattctgcacgttacgcaggcgagcaaaaaaatgccgacgataacatgaataaa
cttttaaaggcattagaaaacaacaaaaatcgaagcgctcagtttaaaaccgttatcact
ttaaacctggaaggaaagcaatatatatttactggaattgcaaaaggagaaattacagaa
accaaaacaggtacaaatggttttggatacgacccaattttcaaacctgaaaattttgac
aaaacctttgcagaactgcctttggaaataaaaaacaccattggacatcgtggaaaagct
gttcagcaactaattgatctcctgactgccacaaaataa

DBGET integrated database retrieval system