KEGG   Flavobacterium johnsoniae UW101: Fjoh_2536
Entry
Fjoh_2536         CDS       T00508                                 

Definition
(GenBank) Copper-exporting ATPase
  KO
K17686  P-type Cu+ transporter [EC:7.2.2.8]
Organism
fjo  Flavobacterium johnsoniae UW101
Brite
Enzymes [BR:fjo01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.8  P-type Cu+ transporter
     Fjoh_2536
Motif
Pfam: E1-E2_ATPase Hydrolase ATPase-cat_bd HMA Hydrolase_3
Other DBs
NCBI-ProteinID: ABQ05563
UniProt: A5FGV9
Position
3018867..3021254
AA seq 795 aa
MSEQSCFHCGLEIPKDEEINFDEKTFCCTGCKTVYEIFSLNDLTCYYDFEKSPGATPQDI
KGKYDFLDNESILAKVLEFQESNTSIVSLNIPHIHCSSCIWILENLNRLNSGISSSQVNF
PEKRVRITFNSEIVSLKEIAYLLSSIGYEPYISLENYETGKTKVDRSLTYKLGVAFFCFG
NIMLLSFPEYFEMKEFWLDSYKPFFRLLIFVLALPSFFYSASGYYVSAYKSIKSGMLNID
IPIALGIIVMFIRSTYDMLMDHGPGFFDSLASLVFFMLLGKMFQIKTYSFLSFERDFKSY
FPIAVTRINSDASEESVPIYDVLKGNRLLIRNQELIPVDGILISEKAEIDYSFVTGEAVP
ITKKSGDKVFAGGKQIGKVIEMEVLHSVSQSYLTQLWSNEVFQKKVQQKHKTITDAISRY
FTPILLLIAFAGFGYWIFIDANTAFNVFTAVLIVACPCALALTAPFTFGNILRIMGKQKM
YLKNALVIEQLDKVDTIVFDKTGTITTNKKSNIIYEGTNISDDNYLLIKNVLRGSNHPLS
RMLYDFLPENKRIKIDDFQEITGKGILAVVEGKEIKIGSSSFVESPVAEVSEIERTALHI
KIDNLYLGKFVFQNQYREGLEKLFATLSKEYNIKVLSGDNDGERNTLEEILPNNTELVFN
QKPEQKLEFIKGLQSQGKNVMMVGDGLNDAGALAQSNVGISVSENVNVFSPACDAILDAG
VFSKLNYFLKLSHKSILIIKMSFTLSLLYNVVGLAFAVTGNLNPLVAAIIMPLSTITIVS
FVTIMSNYFSKSNLD
NT seq 2388 nt   +upstreamnt  +downstreamnt
atgagtgagcagagttgttttcattgcgggcttgaaattcctaaagatgaagagatcaat
tttgatgaaaaaacattttgttgtacaggctgtaaaacagtttacgaaatttttagtcta
aatgatttaacctgttattatgatttcgaaaaatctcctggcgcaactccgcaggatatt
aaaggcaaatatgattttttagacaacgaatctattcttgcaaaagttttagagtttcag
gaatcaaatacttcaatagtttctttaaatatccctcacattcactgcagttcatgtatc
tggattctggaaaacttaaacagattaaattcaggtataagcagttctcaggttaatttt
ccggaaaaaagagttagaatcacttttaattcagaaatcgtatcactgaaagaaattgcc
tatttattgagttcaattggttatgaaccttatataagcttagaaaactacgaaacagga
aaaacaaaagtagacagaagtttaacttataaactgggagttgcctttttctgctttgga
aatattatgctgctttcttttccggaatatttcgaaatgaaagaattttggttagatagc
tacaaaccgttttttagactcttgatttttgttttggctctgccaagcttcttttattca
gcgagtggttattacgtttcggcctataaaagtatcaaaagcggtatgcttaacattgat
attccaattgcattaggaatcattgtaatgtttatacgaagtacttatgatatgctaatg
gaccacggaccgggattttttgacagtcttgccagtttggttttctttatgctgcttggg
aaaatgtttcaaattaaaacctacagttttttaagttttgaaagagattttaaatcctat
tttcctattgctgttacccgaattaattcagatgcatctgaagaaagtgtgccaatttac
gatgttttaaaaggaaacagactcttaattagaaatcaggagctaattcctgttgatggt
attttaattagtgaaaaagctgagatcgattatagttttgtaacgggagaagcagttcca
attacaaaaaaatcgggagataaagtttttgccggcggaaaacaaattggaaaagtgata
gaaatggaagttttacattctgtttctcaaagttacttaacacagttatggagcaatgaa
gtttttcagaaaaaagtgcagcaaaagcataaaacaattacagatgcaataagccgttat
tttacgccaattttattattaattgcatttgcaggatttggttattggatatttattgat
gccaatacagcttttaatgtttttacggcagttttaattgttgcatgcccttgtgcattg
gctttaacagctccgtttacttttggaaacattctcagaataatgggaaaacaaaagatg
tatctaaaaaatgctttggttatagagcaattggataaagttgataccatcgtttttgat
aaaacaggaactattacaaccaataaaaaatcgaatatcatatacgaaggaacaaatatt
tctgacgataattatttgttgattaaaaatgttctccgaggatctaatcatccgttaagc
agaatgttgtatgactttttgcctgaaaacaaacgaattaaaattgatgatttccaggaa
attaccggaaaaggtattctggcagtcgtagaaggtaaagaaataaaaatagggtcttca
tcatttgtagaaagtcctgttgcagaggtatctgagatagaacgaacagcgcttcatatc
aaaatagataatctttatctgggaaaattcgtttttcaaaaccaatatcgcgaagggtta
gaaaaattatttgcaacactcagcaaagagtacaacatcaaagtcctttctggagataat
gatggagaaagaaatactcttgaagaaatcctgccaaacaatacagaattggtttttaat
caaaaaccagaacagaaattagaatttatcaaaggacttcaatcgcaaggcaaaaacgtt
atgatggttggagatggtctaaacgatgctggagctttagcgcaaagtaacgttggtatt
tcagtttctgagaatgtaaatgtattttctccggcctgcgatgcgatcttagatgcaggt
gtattttcaaaattgaattactttttaaaactgtctcataagtcaattttaataattaaa
atgagctttactttatcgctgctttataatgtagtaggattggcatttgcagtcaccgga
aatctaaatccgctcgttgctgcaatcataatgccgcttagtacaattaccattgtaagc
ttcgttactattatgtctaactatttcagcaagagtaatttagattag

DBGET integrated database retrieval system