KEGG   Flavobacterium johnsoniae UW101: Fjoh_2554Help
Entry
Fjoh_2554         CDS       T00508                                 

Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00260  Glycine, serine and threonine metabolism
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01120  Microbial metabolism in diverse environments
fjo01130  Biosynthesis of antibiotics
fjo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fjoh_2554
Enzymes [BR:fjo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Fjoh_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABQ05581
UniProt: A5FGT9
Position
3037634..3038653
Genome map
AA seq 339 aa AA seqDB search
MEINLISDTITKPTYEMLQYMFNAHVGDDVYKQDPTVIELETRVAEFFGMEAGLFFPSGT
MANQTAIKLHTQPGEQLIADKYAHVFHYEGGGVSFNSGVSCCLLDGDRGMINAKQVAAAI
NDPEFYHSPLTSLVCVENTTNKGGGACYELQDLRDIKKVCDANNLKFHLDGARIWNALVA
KRQNPKEFGAIFDTISVCLSKGLGAPIGSVLLGSKADIHRALRIRKILGGGMRQVGYLAA
AGLYALANNIERLAEDHRRAKEIGAILSTKSWVASVEPVETNILIFSLAEGYSDQLLIEK
LKQKNILISSLGHNKLRIVTHLDYKEVMHTYVVETLSKI
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaatttaatcagcgataccattactaagcctacgtatgagatgcttcagtat
atgtttaacgctcacgttggcgacgatgtatacaagcaagatcctacggttatcgaatta
gagacaagagtagccgagttttttggtatggaagctggacttttttttccgtctggaact
atggcaaatcaaactgcaattaaacttcatacacagccgggtgaacagttaattgctgat
aaatatgctcatgtttttcattatgaaggaggaggagtttcttttaacagtggtgtttca
tgctgtttgttagatggagaccgcggtatgataaatgcaaaacaggttgctgcagcgata
aacgatccggaattttaccatagtccgctgacgagtttggtttgtgtagaaaacacaaca
aacaaaggcggaggtgcttgttatgaattgcaggatttaagagatattaaaaaagtttgc
gacgctaataatttgaagttccacttagacggtgccagaatttggaatgcattggttgct
aaaagacaaaacccgaaggaatttggagctattttcgatactatttcagtttgtttgtct
aaaggattaggagctccaattggttctgttttgcttggaagtaaagctgatattcataga
gcgttgagaatcagaaagatattaggtggtggaatgcgtcaggtaggttatttggctgca
gcgggattatatgctttggcaaacaatattgaacgtcttgccgaagatcatcgcagagca
aaagaaattggagcaattttaagcaccaaatcttgggtggcttcagtagaaccagttgaa
acaaatattttgattttttcattagcagaaggctacagcgaccagcttttgatagaaaaa
ttaaaacaaaaaaatattttaataagctctttaggtcataataaacttagaatcgttacg
catttagattataaagaggtaatgcatacttatgtagttgaaacgctttcgaagatttag

DBGET integrated database retrieval system