KEGG   Flavobacterium johnsoniae UW101: Fjoh_3256
Entry
Fjoh_3256         CDS       T00508                                 

Definition
(GenBank) hypothetical protein
Organism
fjo  Flavobacterium johnsoniae UW101
SSDB
Motif
Pfam: O-antigen_lig Wzy_C ASFV_J13L AI-2E_transport Chordopox_A13L Sox_N DUF4131 Glucos_trans_II EphA2_TM
Other DBs
NCBI-ProteinID: ABQ06272
UniProt: A5FEU7
Position
complement(3895387..3895947)
AA seq 186 aa
MIYTLLIILLLEIIFIYLKKWQTKRKILIAICTVIITVIIYVVLLAVLWNSSTDKREDIQ
QVNEYQVQNFKTILFNNQFNKKVYVIINFEYTKDEIKKNNLKIVDFYNKTDSILLKPNEK
NSIFLPVYNNTFVRFPINFKVTIKDSVSKVIKSYDEELFYKESKSEPKIEKVQEKYKSDE
WELIIK
NT seq 561 nt   +upstreamnt  +downstreamnt
atgatttatactttattgattattctgttgttagaaattattttcatttatttaaaaaaa
tggcagactaaaagaaagattttaatagcaatttgtacagtaatcattacagtgattata
tatgttgttttattagcagtactttggaattcatcgacggataaaagagaagatattcag
caggtgaatgaatatcaagtgcaaaactttaaaacaattttgttcaataatcagtttaat
aaaaaagtgtatgtaattatcaattttgaatacactaaagatgagataaaaaaaaataat
ttaaaaattgttgatttttataataaaacagattctatactattaaaaccaaacgaaaag
aatagcattttcctgccagtttacaataatacatttgttcgatttccaataaattttaaa
gttacaatcaaagattccgtatctaaagtaattaaaagttatgatgaagaattattttat
aaagaatcaaaatcagagccaaaaattgaaaaagtacaagaaaaatacaaatctgacgaa
tgggaattaataattaaatag

DBGET integrated database retrieval system