KEGG   Flavobacterium johnsoniae UW101: Fjoh_3257
Entry
Fjoh_3257         CDS       T00508                                 

Definition
(GenBank) hypothetical protein
Organism
fjo  Flavobacterium johnsoniae UW101
SSDB
Motif
Pfam: Glyco_hydro_38C
Other DBs
NCBI-ProteinID: ABQ06273
UniProt: A5FEU8
Position
complement(3895944..3897596)
AA seq 550 aa
MSRIRLVRGTITKTTGGDHNIYSEGNIVYNSGQAVTETSDTGIKYGDPKDIPQRKNDDFD
ITFELDKKTKSVVPLGILDFKNNAENPYFCFKFGLKKTSIDSLNFQIIGENDEIIYQMTY
LQTIIVKASELPKIFSNIPKSTQEPILSKIWDFQKIYNEFASSPGDYTKEGEYVIHWDGF
DNNDVYDSTKFNNKKLKARITATKGDKQKSLTIDFSTNYTQVQWTDVKIDRSKKRIDITL
RVDLRDGGTKGLNCYTYNLPEESSYETFTPTTGTDPLKGYKTTICDWDKIPASELNPAQP
VLKTRTKSFEELKKLAFEGLERYWGRNKNNIVGNNVNIIDSYEVFIKPIDTTKNALNSLP
LVYNTNGGWMRSGNPGASYDDGNLDDDLLNALPDLGVIQRLSYNAGYIKHDWKNDAHNGW
RYHIEKDSNTYYDEVSNFKETAAHELGHEFLQAYAGTAFSWQHKGSSYYLPQDTKPIKGD
ETFWGKMTHMDEMPETSGEYYPKNGEIDLMKYYNTTDKAGKFVAGADLKRTIAAEKDVLG
LIWLTKLKIQ
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgagcagaataagattagttagaggtactataacaaaaactaccggaggtgatcacaat
atttattctgaaggtaatattgtatataattctggtcaggctgtaaccgagacgagtgac
acaggaattaagtacggagatccgaaagatatccctcaaagaaaaaatgatgattttgat
attacatttgaattagataaaaaaacaaagtcagttgttcctttgggtattttagatttt
aagaataatgcagaaaatccttatttctgctttaaatttggtttaaagaagacatcaatt
gattctttaaattttcaaataataggtgaaaatgatgaaattatttatcaaatgacctac
ttacaaacgattatagtaaaagcttctgaacttcctaaaatcttttcaaatatacccaaa
tcaacacaagaaccaattttatctaaaatttgggattttcaaaaaatttataatgaattt
gcatcttcaccaggtgattacactaaagaaggtgaatatgttattcattgggatggtttt
gataataatgatgtttatgacagcaccaaattcaataataagaagttaaaggctagaatt
acggctaccaaaggtgataagcaaaaaagtttgacaatagatttttctactaattatact
caagtacaatggactgacgtaaaaattgatagaagcaagaaacgaattgatataacctta
agagtagatttaagggatggtggtacaaaaggtttgaattgttatacttataatttacct
gaggagtcaagttatgaaacgtttaccccgactacaggaactgatcctcttaaagggtat
aaaacaactatttgcgattgggataaaataccggcttcggaattaaatcctgcacaaccg
gttttaaagactagaacaaaatcttttgaagaattaaaaaaacttgcttttgaaggtctg
gaaagatattggggaagaaataaaaataatattgttggtaataatgtaaatattattgat
tcttatgaagtatttataaaaccaattgatactactaaaaatgctctaaattctctaccg
ttggtgtataatactaatggaggatggatgcggtcaggtaatcctggagcaagctatgat
gatggtaatttagatgatgatttgttaaatgctcttccagatttaggtgtaatacaaaga
ttatcttataatgcaggatatattaaacatgattggaaaaatgatgctcacaacggatgg
cgctatcatattgaaaaagattcaaatacgtattatgatgaagtttcaaattttaaagaa
acagctgctcatgaattaggacatgaatttttacaagcctatgcaggaacagcattctca
tggcagcacaaaggaagttcatattatttacctcaagatactaagcctataaagggagat
gaaaccttttggggtaaaatgactcatatggatgaaatgcctgaaacttcaggagaatat
tatcctaagaatggtgaaatagacctaatgaaatattataatactactgataaagcaggg
aaatttgttgcaggggctgatttaaaaagaacaattgctgcagaaaaggacgtattaggt
ctgatatggttaacaaaacttaaaatacaatga

DBGET integrated database retrieval system