KEGG   Flavobacterium johnsoniae UW101: Fjoh_3266Help
Entry
Fjoh_3266         CDS       T00508                                 

Definition
(GenBank) hypothetical protein
Organism
fjo  Flavobacterium johnsoniae UW101
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TssC Phage_sheath_1C BST2
Motif
Other DBs
NCBI-ProteinID: ABQ06282
UniProt: A5FEU2
Position
complement(3904650..3906020)
Genome map
AA seq 456 aa AA seqDB search
MSSKEAYKGDLDTAVLEPKAVKGISIEKNVEKLAKYGGFDLLEMAIEGVQNLNPDRKARR
KIFLGEVNKAKERETLLKTLELWSSVLSNNEALTDMVAQSEDKCKESEALLQKNLAKAVE
DTREIEAAYRTLALFFKNTESDKVKNVTIVNAELDQLKDLDNTRFIDAIHSELVDNYDRL
DLKNNYGILVIPGYLGSNKVIEKWAKIAHENKVMLVTDFEHLDEPDDVMEMFDAASLTGG
DVYRSNVIMTCNWLVGRGRFDQIGENEDLHVAPSAALAGKIYKTLMSQVTAGKKFGGINE
VDGVKFDLKKSEIANLENLGLVPMVNEYGKVMAFSAKTLFSGDNLGLQTYSVVRVFDYVT
KVLMDFLNRRAFENFTAKTRKEIMNQIVAFLDGITGPDKLIENFEIRRFEQDPIQKDRIY
MDIHMKPYFPAKNFLIKMDGHKGDDGTEWDTDYEQK
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcaaagaagcatataaaggtgatcttgatacagcagtattagaaccaaaagca
gtaaaaggaatttcaattgaaaaaaatgttgaaaaactggctaaatacggcggttttgat
ttattagaaatggcaattgaaggagttcaaaaccttaacccggatagaaaagcaagaaga
aaaatctttttaggtgaagtaaacaaagcaaaagaaagagaaactcttttaaagacttta
gaactttggtcttcagttttaagcaataatgaagctttgactgatatggtggcacaaagt
gaagataaatgcaaagaatctgaagctttgcttcaaaaaaaccttgctaaagctgttgaa
gatacaagagaaattgaagctgcttacagaacactggctttattctttaaaaacacagaa
tctgacaaagtaaaaaatgttacaattgtaaacgcagaattagatcagttaaaagacctt
gataacactcgttttattgatgcaattcactcagaattagttgataattacgatcgttta
gatcttaaaaataactacggtattttggtaattccaggatatttaggatctaacaaagtg
attgaaaaatgggcaaaaattgcgcatgaaaacaaagtaatgttagttacagatttcgaa
catcttgatgaaccggatgatgtaatggaaatgtttgatgctgcttcattgactggagga
gatgtttatcgttctaacgtaatcatgacttgcaactggcttgttggccgcggcagattt
gatcaaattggagaaaacgaagatttacacgttgcgccttcggctgcattagcaggaaaa
atatacaaaacattaatgtctcaggttactgcaggtaagaaatttggaggaattaatgaa
gttgacggagtgaaatttgatcttaagaaaagcgaaatcgctaatcttgaaaacttagga
ttagttccgatggtaaatgaatacggaaaagtaatggctttttctgctaaaacattattc
agcggagataatttaggattgcaaacgtactctgtagttcgtgtttttgattatgtgact
aaagtattaatggatttccttaatcgtcgtgctttcgaaaactttactgctaaaacacgt
aaagagattatgaatcagatcgttgctttccttgacggaatcactggtccggataaatta
attgagaattttgaaatccgcagatttgaacaagatccaattcaaaaagacagaatttat
atggatatccatatgaaaccttatttccctgctaaaaacttccttattaaaatggatggt
cacaaaggtgacgacggaacagaatgggatacagattacgaacaaaaataa

DBGET integrated database retrieval system