KEGG   Flavobacterium johnsoniae UW101: Fjoh_3939Help
Entry
Fjoh_3939         CDS       T00508                                 

Definition
(GenBank) Trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
fjo  Flavobacterium johnsoniae UW101
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Fjoh_3939
Enzymes [BR:fjo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     Fjoh_3939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_12 MTS PCMT FtsJ Methyltransf_32 TehB Methyltransf_33 Methyltransf_4 Ubie_methyltran GidB DREV MetW DPCD PrmA Methyltransf_9
Motif
Other DBs
NCBI-ProteinID: ABQ06949
UniProt: A5FCX3
Position
complement(4693024..4693791)
Genome map
AA seq 255 aa AA seqDB search
MPWNPEIYNTFKDIRYKPFYDLADLIKPVKNKKAIDLGCGTGEQTAILADKFKEVHFLGV
DSSAEMLEKSKALETENLHFRRASTEEMIENAEKWDLIFSNAALQWSNNHEILFPKLIHL
LNSKGQFAVQMPMQPENKLNKILIELVNEEPFKTYLKGFKRDSPVLSIDEYAQILFDSGL
EDIQIMQKVYPIIANDHDTLYNFISGSALIPYMEKLEGGQKELFIKTYKERIAESFPKLP
AIYSFKRLLLYGTKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgccttggaatccagaaatatacaatacatttaaagacattcgttataaaccattttat
gatttggctgatttgataaagccagtcaaaaataagaaagccattgatttaggatgcggt
acaggcgaacaaaccgctattttagcagataaatttaaagaagtccattttcttggtgtt
gattcttcggcagaaatgctcgaaaaatcaaaagcattagaaacagaaaacctgcatttt
cgcagagcatcaaccgaagaaatgattgaaaatgccgaaaaatgggatttaatttttagc
aatgccgctttgcaatggtcgaataatcatgaaattttgtttcctaaattgatacacctt
cttaattcaaaagggcagtttgcagttcaaatgccgatgcaaccagaaaataaactcaac
aaaattttaatcgaattggttaacgaagaaccttttaaaacgtatctaaaaggctttaaa
agagattcacccgttttgagtattgatgaatatgcgcagatactatttgacagcggactc
gaagatattcaaatcatgcagaaagtgtatcccataattgcaaacgatcacgatacgttg
tataatttcatttcaggttcagctttaattccatacatggaaaaacttgaaggcggacag
aaagaactttttataaaaacatacaaagaaagaatagcagaaagttttcctaaacttccg
gcaatttattcttttaaaagacttttgctttacggaacaaaagcataa

DBGET integrated database retrieval system