KEGG   Flavobacterium johnsoniae UW101: Fjoh_4167Help
Entry
Fjoh_4167         CDS       T00508                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00010  Glycolysis / Gluconeogenesis
fjo00071  Fatty acid degradation
fjo00350  Tyrosine metabolism
fjo00625  Chloroalkane and chloroalkene degradation
fjo00626  Naphthalene degradation
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01120  Microbial metabolism in diverse environments
fjo01130  Biosynthesis of antibiotics
fjo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fjoh_4167
  Lipid metabolism
   00071 Fatty acid degradation
    Fjoh_4167
  Amino acid metabolism
   00350 Tyrosine metabolism
    Fjoh_4167
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Fjoh_4167
   00626 Naphthalene degradation
    Fjoh_4167
Enzymes [BR:fjo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Fjoh_4167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Sacchrp_dh_NADP TrkA_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABQ07175
UniProt: A5FC99
Position
complement(4994298..4995323)
Genome map
AA seq 341 aa AA seqDB search
MKAVRFFGTNDVRIVNDLEKPSPKGDEVLLKIGGAGVCHSDLHIIDEGIVSGVTFTLGHE
NAGWIEEIGDDVKGFKKGDAVLVYGPWGCGHCKPCQHSNENYCDHQSEMAYGGGLGLNGG
MAEYMLVPSSRLLVPIHDLDPVVAAPLTDAALTPYSAIKRSLPKLMPDEYVVVIGVGGLG
HVALQILSEMCSSAIIACDITQERLDFAKKLGAAHVVNSMDKDAAEQIRNITGIKKAKVV
IDFVGASSTIDLGTKIVGLDGDLTIVGLGGGKYEYNMNVLPFGVSMTNPYWGSRTELMEV
IGLALQKKIKIEIQKFKLDEAVEVYDKLRKGQIKGRAVLVP
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtacgattttttggaacaaacgacgttagaattgtaaatgatcttgaaaaa
ccatcgccaaaaggagatgaggtacttttaaaaataggaggagcaggagtatgccattca
gaccttcatattattgatgaaggaatagtctcgggagtaacatttactttaggacacgaa
aatgcaggatggattgaagaaataggagatgatgtaaaaggttttaaaaaaggcgacgcc
gttttagtatacggtccctggggatgcggacattgtaaaccgtgtcagcattctaatgaa
aattattgtgaccaccaatcagaaatggcttacggaggcggattaggtttaaacggaggt
atggcagagtatatgcttgtgccgtcttcacgattattagtaccaattcatgatttagat
cccgtagttgcagcacctttaacagatgccgctttaacaccatattctgccataaaacgt
tcacttccaaaattaatgcctgatgaatatgttgtagtaataggagtaggtggtttagga
catgttgcacttcaaattttatcagaaatgtgctcttctgcaattattgcctgcgacatt
actcaggaaagattagattttgccaaaaaattaggagctgctcatgtcgttaactctatg
gataaagatgcagcagaacaaatacgaaacattaccggaatcaaaaaagcaaaagtggta
atagattttgttggagcttcatcaacaatagatttaggaactaaaattgttggtttagac
ggagatttaaccattgtaggtcttggaggaggaaaatacgaatacaacatgaatgtactg
ccttttggagtaagcatgaccaatccgtattggggttccagaaccgaattaatggaagtg
ataggacttgcacttcagaaaaaaataaaaattgaaattcaaaaattcaaattagacgaa
gctgttgaagtgtatgataaattaagaaaagggcaaataaaaggaagagcagtattagtt
ccataa

DBGET integrated database retrieval system