KEGG   Flavobacterium johnsoniae UW101: Fjoh_4474
Entry
Fjoh_4474         CDS       T00508                                 

Definition
(GenBank) ATPase, P-type (transporting), HAD superfamily, subfamily IC
  KO
K01537  P-type Ca2+ transporter type 2C [EC:7.2.2.10]
Organism
fjo  Flavobacterium johnsoniae UW101
Brite
KEGG Orthology (KO) [BR:fjo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Fjoh_4474
Enzymes [BR:fjo01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.10  P-type Ca2+ transporter
     Fjoh_4474
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Hydrolase_3 Cation_ATPase_N Cation_ATPase
Other DBs
NCBI-ProteinID: ABQ07475
UniProt: A5FBE4
Position
5393352..5395868
AA seq 838 aa
MTTYNIPNHLKGLTVNEVKVSRERYGYNRMEAIGKNSLLDMLINILKEPMLILLFAISII
YVIVGDYGEALFMFLAIIAVSAISFYQDNRSKKALAELEKLNEPLSTVIRNSEVVKIATH
DIVIGDLCITEEGRIINADGRIVHSNDFSVNEASLTGESFSVFKNSDPGNNKIFSGTIAV
SGLAVFEVEQIGKQTQIGKIGESILTIKEEISPLQVQIRKFVKWMAVAGILIFLMVWMFS
FIRTGNLVDSLLNGLTMAMSVLPEEIPVAFTTFMALGAWKLMREGIIIKRSSIVETLGST
TVICTDKTGTITENSMQLKQLYDYRSDKTFDEKEFANPELAALIDYAMWSSEPVPFDPME
KTLHQVYEQTQRDDVRKDYQMFHEYPLEGKPPMMTHLFGNSEKERIIAAKGAPEAILAVA
TLSDTEKDKIRGLIREFGQQGYRVLGVAKSGFEGNDFPERQQDFEFEFLGLVVFYDPPKE
GIREVFRHIYEAGIKVKVITGDNADTTRSIASQAGIVNTAEVLNGTDVAAYSEEALIPVA
ERTVLFTRMFPEAKLSVVNALKKKGEVVAMLGDGVNDGPALKAAYIGVAMGNKGTEIAKA
AASLVITNDDLEKLVIGIAAGRRIYANIKKAIQYIISIHIPIILTVSLPLFLGWIFPQIF
TPVHVIFLELVMGPTCSIVYENEPMEKNMMQQPPRAMIDTFLNLRELAISIIQGLVITAG
VLFAYQWSVLNGGSEEKTRAMVFTTLIIANILLSLVNRSFSYSVFDSFKNKNPLFPVITG
LTLVLLFAILYIAPATNFFHVTGLDLQELGMTLSVAAVSVLWFEIYKLFRRMKKSTLM
NT seq 2517 nt   +upstreamnt  +downstreamnt
atgacaacttataatatacccaatcatctaaaagggctgacggtaaacgaggtaaaggtt
tcccgggagcggtatggctacaaccggatggaggcaattggcaaaaattccctgctggat
atgttgatcaacatattgaaagagccaatgctaatcctgctctttgctatttcaattatc
tatgtgatcgtaggcgattatggcgaagcactgtttatgtttctggccattattgccgta
tctgctatttccttttatcaggacaaccgcagcaaaaaagcactggcggaattagaaaag
ctgaatgaaccgctgagcacggtaatcagaaattcggaagtggtcaaaatagctacgcat
gatattgtcataggcgatttgtgcattacggaagaaggaaggatcatcaatgccgacggg
cggattgtccacagtaatgacttttcagtcaatgaagcatcattaaccggtgagagtttt
tctgtattcaaaaacagtgatccggggaataataaaatttttagcggaacgattgccgtt
tcgggattggcggtctttgaagtagaacagattggaaaacaaacgcaaatcggcaagatc
ggcgaatctatcctgacgataaaagaagaaatttcaccattgcaggttcagatacggaaa
tttgtaaaatggatggctgttgccggtatcctcatttttctaatggtttggatgttcagt
ttcatacggacgggtaatcttgttgacagtctgttgaacggtcttaccatggcgatgtct
gtccttcccgaagaaattcccgttgcattcaccacgtttatggctttgggtgcctggaag
ctgatgcgggagggcatcatcataaaaagaagcagtatcgtagaaacgttaggcagtacc
acggttatctgtaccgataaaacaggtactattaccgaaaactctatgcagcttaaacag
ttgtatgattaccgatctgacaaaacttttgatgaaaaagaatttgccaaccccgaactg
gcagcattgatagactatgcgatgtggagtagcgaacccgttccgtttgacccgatggaa
aaaacgcttcaccaggtgtatgaacagacacaaagagacgatgtaagaaaagattaccag
atgttccacgaatatccattggaaggtaaaccacctatgatgacgcatcttttcggaaat
tcagaaaaagaaagaattatagctgccaaaggagctcccgaagctattcttgctgtcgct
acgctctcggataccgaaaaggataaaatcagaggccttatcagggagttcgggcagcag
ggataccgggtgttgggagtagccaaatccggttttgaaggcaatgattttccggaaaga
caacaggattttgaatttgaatttttgggattggttgtgttctatgatcctccgaaggaa
gggatacgggaagtattccgtcatatttatgaagcaggcatcaaggtgaaggtaatcacg
ggagataatgctgatacaacacgcagcatcgcctcccaggcaggcatcgtcaataccgct
gaagtcctgaacggaaccgatgtggcggcttactcggaagaagcattaataccggtggct
gaacgcaccgttttatttacccggatgtttcccgaagctaaacttagcgtggtgaatgca
ctgaaaaagaaaggtgaagtggtggcgatgctgggcgatggtgtaaatgacggccctgct
cttaaagcagcttatataggcgtggcaatgggcaacaaaggaacagaaattgcaaaagca
gccgcatctttggtgataaccaatgacgaccttgaaaaattagttataggtattgctgcc
ggaagaaggatttatgccaatatcaaaaaagctatacagtacatcatttctatccatata
ccaattatactgacggtatctttgcctttatttttgggctggatatttccacagatattt
acacctgtacacgttatctttctggaattggtgatgggacctacctgctccattgtgtat
gaaaacgaaccgatggagaaaaatatgatgcaacaaccgcccagagcaatgatcgatacc
tttttgaatttgcgtgagttggccatcagtatcatacaggggttagtaatcacagcaggc
gtattatttgcctatcaatggtctgttctgaatggtggcagcgaagaaaaaacaagggca
atggtttttaccacactgattatcgcaaatatattgttgagcctcgtgaaccgttccttc
tcttacagtgtgtttgacagcttcaagaataagaatcccctcttcccggttattaccggt
ctaactttggtattactttttgccatactgtatattgcacctgctacaaatttctttcac
gtaaccggattggacttacaggagttagggatgacattatcggtagcggcggtttcagtt
ttgtggtttgaaatttataaattgtttagaagaatgaaaaaatcaacccttatgtga

DBGET integrated database retrieval system