KEGG   Flavobacterium kingsejongi: FK004_00370Help
Entry
FK004_00370       CDS       T05683                                 

Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
fki  Flavobacterium kingsejongi
Pathway
fki00360  Phenylalanine metabolism
fki00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fki00790  Folate biosynthesis
fki01100  Metabolic pathways
fki01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fki00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    FK004_00370
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FK004_00370
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FK004_00370
Enzymes [BR:fki01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     FK004_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H MIX
Motif
Other DBs
NCBI-ProteinID: AWG23788
UniProt: A0A2S1LJ95
Position
84394..86151
Genome map
AA seq 585 aa AA seqDB search
MKTFESNPLLDRLPKHLKQFIKPQDYDEYTPINQAVWRYVMRKNVDYLSKVAHESYLIGL
KKTGLETEHIPNMYGMNRILKEIGWAAVAVDGFIPPNAFMEFQAYNVLVIASDIRQLEHI
EYTPAPDIIHEGAGHAPIIANPEYAEYLRRFGEIGCKAISSSRDYEMYEAIRLLSILKEA
EGTPQNEIDAIEKKVEDLQNNMGELSEMALIRNLHWWTVEYGLIGDLNNPKIYGAGLLSS
IGESAWCMTDSVTKIPYNIDAAYRSFDITKPQPQLYVTPDFAHLNSVLEEFANTMALRTG
GLTGIQKLIQSNALGTIELSTGIQVSGVFTNVIAENNKPVYLQTTGKTALSYREKELVGH
ATSYHSEGFGSPVGKLKGINLAIEDMSPRDLQAYAIYEGERVTLEFEGNITVSGKIITGT
RNIQGKIIIISFTDCTVKHNETLLFQPEWGIYDMAVGKKIVSAYSGPADINSFDLITHVP
SSTTIKAQKNSKREELESLYQNIRNIREGKTPVMSIAETFNAVKQNHPKDWLLSLEISEL
LNKDNDTELLQKVLIHLEKLKQTRPEIAHLITGGLELIFENENVN
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgaaagcaatcccttattagatcgtttaccaaaacacttaaaacaattt
ataaagccgcaggattatgatgaatatacacctattaatcaggctgtatggcgctatgta
atgcgtaaaaatgttgattacctttcaaaagttgcccatgaatcctatttgatagggctt
aaaaaaacaggtctagaaacagaacatattcccaatatgtatggtatgaaccgcatctta
aaagaaattggatgggctgctgtggctgtagatggttttatacctcctaatgcatttatg
gaattccaggcttataatgtcctggtaattgcctctgatatccgacaactggaacatatt
gaatacacacccgcaccagacatcatccacgagggagccgggcacgcaccaatcattgca
aatccggaatatgccgaataccttaggagatttggtgaaattggctgtaaggctatttcc
tcttcccgcgattatgaaatgtatgaagcgatccgactactttcgatattaaaagaagcc
gaaggaactccacaaaatgaaattgacgctattgaaaaaaaggtggaagatttgcagaat
aatatgggggaactatccgaaatggcacttatcagaaacctgcactggtggactgttgaa
tatggccttatcggtgacctcaacaatcctaaaatatatggcgcagggctactttcttca
ataggagaaagcgcctggtgcatgaccgatagcgtgactaaaataccgtataacattgac
gcagcataccgcagttttgatatcaccaaaccacagccccaattgtatgttaccccagat
ttcgcccatctaaactctgttttagaagaatttgccaataccatggctttacgaaccggc
ggcctaacaggaatacaaaaactgatacaatccaacgcgttgggcacgattgaattgagc
accggaattcaggtttcaggtgtttttacaaatgtcattgccgaaaacaacaaaccggtg
tacctgcaaactaccggtaagacagcactatcctacagagagaaagaattagtcgggcat
gccacatcctatcattcagaaggttttggaagccctgtaggcaaactaaaaggcattaat
cttgctatcgaagacatgagcccgcgggatcttcaggcgtatgcaatatatgaaggggaa
cgtgttacgcttgagtttgaaggaaatattacagtatccggtaaaatcattacaggcacc
cgaaacatccagggaaaaattatcattatcagctttaccgattgcacagtaaaacacaat
gaaacgcttttattccaacctgaatggggcatttacgatatggccgtgggtaaaaaaata
gtctctgcctattccggacctgcagacatcaacagttttgacctgattactcatgtccct
tccagtaccactattaaagctcaaaaaaacagcaagcgggaagaactggaatcattatac
cagaacatcagaaacatccgcgaaggaaaaacaccagttatgtccatcgccgaaacattt
aatgccgtgaagcaaaatcaccctaaagactggctgttatccttagaaatatctgaatta
ctaaacaaagacaacgatactgaattactccagaaggtacttatccatttggaaaaatta
aaacaaacccgacctgaaattgcacatttgattaccggcggtttagaacttattttcgaa
aatgaaaatgtaaactaa

DBGET integrated database retrieval system