KEGG   Flavobacterium kingsejongi: FK004_07095Help
Entry
FK004_07095       CDS       T05683                                 

Definition
(GenBank) glycerol-3-phosphate cytidylyltransferase
  KO
K00980  glycerol-3-phosphate cytidylyltransferase [EC:2.7.7.39]
Organism
fki  Flavobacterium kingsejongi
Pathway
fki00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fki00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    FK004_07095
Enzymes [BR:fki01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.39  glycerol-3-phosphate cytidylyltransferase
     FK004_07095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like Pantoate_ligase
Motif
Other DBs
NCBI-ProteinID: AWG25012
UniProt: A0A2S1LMN9
Position
1625067..1625522
Genome map
AA seq 151 aa AA seqDB search
MKMDLEIQRIGITFSAFDLLHAGHIKMLEDAKKICDYLIVGLQTDPTIDRPGKNRPTQSV
VERYIQLKGCKYVDEIVPYTTEQDLEDILRSFTVHVRIIGDEYKKKEFTGRKYCEEKGIE
LFYNTRDHRFSSSGLRKVVYDCECSKVEQSA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatggatctagaaatacaaagaataggaattacatttagcgcttttgacttattg
catgcagggcatataaaaatgctggaagatgccaaaaaaatatgcgattacctgattgta
gggctgcaaacagatcctacaattgaccgtcctggaaaaaacaggccaacacaatcagta
gtcgaaagatatatacagttgaaaggctgtaagtatgtagatgaaatagttccttatact
acagagcaggatctggaagatatactgcgttcttttaccgttcacgtgcgtatcataggt
gatgagtataaaaagaaagaatttaccggtaggaaatattgcgaggaaaaaggaattgaa
cttttctataacacacgtgaccatcgcttttccagcagcggattgcgtaaagttgtgtac
gattgtgaatgtagtaaagtagagcaaagtgcttaa

DBGET integrated database retrieval system