KEGG   Flavobacterium kingsejongi: FK004_11850Help
Entry
FK004_11850       CDS       T05683                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
fki  Flavobacterium kingsejongi
Brite
KEGG Orthology (KO) [BR:fki00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fki01002]
    FK004_11850
Enzymes [BR:fki01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     FK004_11850
Peptidases and inhibitors [BR:fki01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   FK004_11850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: AWG25863
UniProt: A0A2S1LQ32
Position
2655802..2657844
Genome map
AA seq 680 aa AA seqDB search
MKLQTFAGLFLASAVLLSCNKEKTAVAEKEAPKTKTENSDYKVDQFADIEVLRYKVPGFE
NLTLKEKKLVYYLTQAGLSGRDIFWDQNYKHNLKIRKALENIYQNYKGDKNAQDWTNFEI
YLKRVWFSNGIHHHYSNEKIKPDFPQGYFIKLLSDTKTTLEPEVVSILFNDVDAKKVNLD
ESKGLLSGSAINFYDKGITAKEVEDFYAKKTSPDPKRPYSYGLNSKLVRNAKGELEEKVW
KSGGMYGAAIDKIVFWLEKAKTVAENKKQGDALGLLISYYKSGDLKTWDDYNIAWLQATE
GNIDYINSFIEVYNDPLGYRGSYESTVQIKDFEMSAKMEVISKNAQWFENNSPLQPEHKK
KKVVGITYKTVVVAGESGDASPSTAIGVNLPNSDWIRAEYGSKSVSLGNIIDAYNHAGGS
DKVKEFANDKEEIELEEKYGEIADKMHTALHEVVGHASGQINPGVGTPKETLKSYASTLE
EGRADLVGLYYLYSPKLQELGLVDDWQKVGKAAYDGYIRNGLMTQLVRLDQGADIEEAHM
RNRQWVSAWVFEKGKKDNVIEKITRDGKTYFNITNYEKLHELFGELLKETQRIKSEGDYN
AGKALVENYGVKVDQKLHKEVLERNKKFNAAAYKGFVNPVLVPKTDAKGEITAIEIQEPK
TFAEQMLFYSKNYNFLPDTN
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacaaacatttgccggcttgtttttggcttcggctgtgctgctttcctgtaat
aaggaaaaaacggctgtagcagaaaaagaagcaccaaagacgaaaactgaaaattccgac
tataaagtagatcagtttgccgatattgaagtactgcggtacaaagtacccggatttgaa
aacctgacactgaaagaaaagaaattggtatattacctcacacaagccgggctttccggg
cgtgatattttctgggatcagaactacaagcacaacctgaaaatcaggaaagcactggaa
aatatttaccaaaattacaaaggcgataaaaatgcacaggactggactaattttgaaatt
tacctgaaaagggtatggttttctaatgggatccaccaccattattccaacgaaaaaatt
aaaccggattttccacaaggctactttatcaaattgttatcggataccaaaacgactttg
gaacctgaagttgtatccatcctgttcaatgatgtagatgctaaaaaggtaaatctggac
gaaagcaaaggattgctttccggctctgcgattaatttttatgataaaggaattaccgct
aaggaagtagaagatttttatgctaaaaaaaccagcccggatcctaaaagaccgtattcg
tatgggctaaattccaaattggtacgcaatgccaaaggggaactggaagaaaaagtttgg
aaaagcggcggaatgtatggtgctgcaatcgataaaattgttttttggctggaaaaagca
aaaacagtagccgaaaataaaaaacagggcgatgctttagggctcctgatcagttattac
aaatccggagacctgaaaacctgggacgattataatatcgcatggttacaggctaccgaa
ggtaatattgactatatcaatagttttattgaagtgtataatgatcctttaggctataga
ggctcttatgagagtacagtacaaattaaggatttcgaaatgtcagccaaaatggaagtt
atttctaaaaatgcccaatggtttgaaaacaactctcctttacaaccggaacataaaaag
aaaaaggtagtagggattacctataaaacggtagttgtagccggagaatccggtgatgcc
tcacccagtactgctattggggtaaacctgcctaattctgactggattcgtgcagaatac
ggctctaaatcggtttctttaggaaacatcatagatgcttacaaccatgccggaggttcg
gataaagtaaaagaatttgccaacgataaggaagaaatagaactggaagaaaaatatggt
gaaatagcggataaaatgcacacggcactgcatgaagtggtagggcacgcttcgggtcag
attaatccgggagtaggcacaccaaaagaaaccctgaaaagttatgcttccacactggaa
gaaggcagggcagatttagtaggcctgtattatctctatagtccaaaactccaggaactg
ggattggtagacgattggcaaaaagtaggaaaggcggcttatgatggttatatccgaaat
ggattgatgacacaattggtacgtctggaccagggggcagatattgaagaagcacacatg
agaaaccgtcagtgggtgagtgcctgggtatttgaaaaagggaaaaaggataatgttatc
gagaaaatcacccgtgatggaaaaacctattttaatattacaaattatgaaaaactgcat
gagctttttggtgaactattgaaagaaacccaaaggataaaatcggaaggggattataat
gccggtaaagcactggtggaaaattatggtgttaaagtagatcagaagttacacaaagaa
gtgctggaacgcaataaaaaattcaatgcagcagcttataaaggatttgtaaatccggta
ctggtaccgaagacggatgcaaaaggcgaaattaccgccattgaaatccaggaacctaaa
acctttgcggagcagatgttgttttattccaaaaattacaacttccttcccgataccaat
taa

DBGET integrated database retrieval system