KEGG   Flavisolibacter tropicus: SY85_12825Help
Entry
SY85_12825        CDS       T04392                                 

Definition
(GenBank) glycosyl hydrolase family 32
  KO
K03332  fructan beta-fructosidase [EC:3.2.1.80]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00051  Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SY85_12825
Enzymes [BR:fla01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.80  fructan beta-fructosidase
     SY85_12825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-ProteinID: ANE53469
UniProt: A0A172U2A1
Position
complement(3034605..3036101)
Genome map
AA seq 498 aa AA seqDB search
MVKPLTAQPHKTDDVPASYKEPYRPQIHFSPKEKWMNDPNGMVYYKGTYHLFYQYYPDST
VWGPMHWGHATSKDLIHWQHQPIALYPDSLGYIFSGSAVVDKNNTSGFGKSGKVPLVAIF
THHDPVGDKAGRNDYQVQSLAYSLDDGKTWIKYAGNPVLKNPGIKDFRDPKVFWFEAGKK
WIMTLAVLDHIAFYSSKDLKNWSKESEFGKDLGAHGGVWECPDLFELKGNGKKVWVLLVN
LNPGGPNGGSATQYFIGDFDGKTFTTSHRDTRWLDYGPDEYAGITWSNTSNRKIFLGWMS
NWLYGTVVPTDRWRSAMTLPRDLALKQVGKDWFITSWPSKELNVITGKPVVLQNLKVQDH
LDLATKLPAVAFPCRIDINLETAATHAVVLSNAAGEELVVGYDKQGNQYYIDRRHSGKVD
FQKDFASRSVAPRISSANSMNLTLVIDISSVELFADNGLSVMTGIFFPSTPYTNVQLRAP
VGIIIKKMVYTRLSSIWK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
attgtaaagccattgacagcacagccacataaaactgatgatgtaccagcatcgtataaa
gagccttatcgcccacagatccatttttcacccaaagaaaaatggatgaatgatcccaat
ggtatggtatattataagggtacataccatttgttttaccaatattacccagatagtacc
gtatggggacccatgcactggggacatgccaccagtaaagaccttatacattggcagcat
cagcctattgctttataccccgatagccttgggtatattttttcgggtagtgctgttgta
gataagaataatacttcgggttttggaaaaagcggcaaggttccgttggtagctattttt
acgcatcacgatccggtaggcgacaaagctgggcggaacgactaccaggtgcaaagctta
gcgtatagcctggatgatggcaagacatggatcaagtatgcgggtaatcctgtgctgaag
aatccaggtatcaaggactttcgcgatcccaaagtattctggtttgaggccggtaaaaaa
tggatcatgacattagctgtattggaccacattgctttttattcttccaaggatttaaag
aactggtcaaaagaaagtgagtttggtaaagaccttggcgcgcatggtggtgtatgggaa
tgtcctgatctgtttgagttgaagggcaatggtaaaaaggtatgggtgctgctggtcaac
ctgaatcccggcggccctaacggtggatcggcaacacagtattttattggtgactttgat
ggcaagacttttaccacttcgcatagggatacgcgttggctggattatggccccgatgaa
tatgcaggtattacctggtccaataccagtaacaggaaaatattcttaggctggatgagc
aactggctttatggtacagtagtgcctaccgaccgatggcgcagtgctatgaccctgcca
cgtgatctggcattgaaacaagtaggtaaggattggttcattacgtcatggccttcaaag
gagttaaatgtaataactggtaagcctgtagtgcttcaaaacctgaaagtacaagaccat
cttgacctggcaactaagttgccggctgttgcctttccatgtcgtattgatatcaatttg
gaaactgcagctacacatgcggtggtattgtctaatgcagctggtgaagagttggtagtt
ggatatgataagcaaggcaaccaatattatattgatcgccggcattcaggtaaggtggat
tttcagaaagactttgccagtagaagtgtagcgcctcgcatttcttcagcaaacagtatg
aacctgacacttgttattgacattagctcagtagagttatttgcagacaatggcttaagt
gtaatgaccggtatcttctttccttcaacgccatatacgaatgtgcaactgagggctcca
gtcggcattattattaaaaaaatggtctatacccgcttgtccagtatttggaagtag

DBGET integrated database retrieval system