KEGG   Flavisolibacter tropicus: SY85_21040Help
Entry
SY85_21040        CDS       T04392                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00230  Purine metabolism
fla00250  Alanine, aspartate and glutamate metabolism
fla01100  Metabolic pathways
Module
fla_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SY85_21040
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SY85_21040
Enzymes [BR:fla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     SY85_21040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: ANE52595
UniProt: A0A172TZS2
Position
4911863..4913140
Genome map
AA seq 425 aa AA seqDB search
MVDVILGLQWGDEGKGKIVDYFASQYDIIARFQGGPNAGHTLYVGAENTKVVLHQIPSGV
FHQGTTNLIGNGVVLDPVTLRRECATVAGFGVDLKKNLFISERAHLILPTHRALDKAAEQ
SKGEEKIGSTLKGIGPAYMDKTGRNGIRVGDLLQKNFTTSYIKLRLKHQKLLDNYNFNED
ISAWEEEFFEAVEFLKTLNIVNGEYFINDALAKGKKVLAEGAQGSMLDIDFGTFPFVTSS
NTVSAGVCSGLGVAPQRIREVIGVSKAYCTRVGSGPFPTELHDATGEELRKIGNEFGATT
GRPRRCGWMDLVALKYACFLNGVTSIVMTKADVLDAFDTLQLCTSYKVDGVATEQVPYQM
VGKTIEPQYQSYKGWKTNSSVIKDVDSLPEAMKDYVKVISEYLGTPISFISNGPGRDQIV
KTEKK
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggtagatgttattttaggcttacaatggggagacgaaggcaagggtaaaattgttgac
tactttgcttctcaatacgatattatcgcacgttttcagggtgggcctaacgctggtcac
actttgtatgtaggtgcagaaaacacaaaagtggtgttacaccaaatcccttctggtgta
tttcatcaaggcacaaccaatttaattggaaatggggttgtgttagacccggtaaccttg
cgaagagaatgtgctacagtagcaggctttggcgtagacttaaaaaagaacctgtttatt
tctgaaagagcgcacttaattcttcctactcaccgggctttagataaagctgctgagcaa
tcgaaaggtgaggaaaagatcggttctaccttaaaagggatcggaccagcttatatggac
aaaactggtcgtaatgggatccgtgtaggtgatctattgcaaaagaactttaccacatct
tatataaagctgcgtttaaagcaccaaaagcttttagataactacaatttcaatgaagat
atctctgcttgggaagaagagttttttgaggcggttgagtttttgaaaaccttgaatatc
gtaaacggtgaatactttatcaacgatgcgttggcaaagggtaaaaaagtgctagctgaa
ggtgctcaaggtagtatgttggatattgactttggtacattcccctttgttacttccagc
aataccgtttctgctggtgtttgtagcggtttaggcgtagcccctcaaagaatccgtgag
gtaattggtgtatcaaaagcgtattgtacccgcgtaggtagcggtcctttcccaacagaa
ttgcatgacgcaacaggtgaggagttaagaaagataggtaatgaatttggcgctactaca
ggacgcccacgccgttgtggctggatggacctggtggccttgaaatatgcctgcttctta
aatggtgttacttcaattgtaatgacaaaggccgacgtattggatgcttttgatacatta
caactgtgtacgtcctataaagtagatggtgtagccacagaacaagtgccttaccaaatg
gtgggtaaaaccattgagcctcaatatcagagctataagggttggaaaaccaattcttct
gttataaaagacgtagatagcttgcctgaggctatgaaggactatgtaaaggttatctct
gagtacttgggtactcctatctcgtttatttctaatggccctggccgcgatcaaatcgta
aaaacagaaaaaaaataa

DBGET integrated database retrieval system