KEGG   Flavisolibacter tropicus: SY85_24805Help
Entry
SY85_24805        CDS       T04392                                 

Definition
(GenBank) histidine decarboxylase
  KO
K01590  histidine decarboxylase [EC:4.1.1.22]
Organism
fla  Flavisolibacter tropicus
Pathway
fla00340  Histidine metabolism
fla01100  Metabolic pathways
fla01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    SY85_24805
Enzymes [BR:fla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.22  histidine decarboxylase
     SY85_24805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANE53203
UniProt: A0A172U2F1
Position
5880253..5881392
Genome map
AA seq 379 aa AA seqDB search
MQELYKEQLQLFLNRIKQRSQNFIGYPASVDYDYKELFPFLDYSLNNVGDPFVESNCDMD
SKKFEREVLNFFADQFHAPKNNWWGYVTNGGSEGNLYALYLARELYPNGMVYYSESTHYS
VQKNIHLLNMDSIVIRTDYKGEMDYDDLKEMIQLQRHRPVIILANIGTTMTEAKDNVPLI
KDILKRLAIKSSYIHCDAALAGTYLSLLGQGSFDFSYGADSIAISGHKFIGSPIPCGVVL
VKKSYKDRIGRSIPYIGTLDTTISGSRNGITPLFLWYTIQKLGRQGLLERAENCLTVADY
ALQLLEEAGINAWRNENALTVVFPQPNEHICKKWQLASENEMSHLICMPGVTKSHIDAFV
NDLVQQQDEKCPDLESQLN
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaattatacaaagagcaattacagctgtttttaaataggatcaaacaacgctct
caaaactttatcggataccctgcatcggtagattatgattataaggaattatttcccttt
ttggattattccttaaataatgtaggagatccgtttgtggagtccaattgtgatatggat
tccaaaaagtttgagcgtgaagtattgaacttttttgccgatcaatttcatgcacccaag
aacaattggtggggctatgttaccaatggtggttcagagggaaatttatatgccttgtat
ctggccagggaattatacccgaatggtatggtgtattactccgaatcaacccattacagt
gtacaaaagaacattcacttactgaacatggacagcatcgtgatccgcaccgattataaa
ggagagatggattacgacgatctgaaagaaatgattcagttacaacggcaccgacctgtg
atcattttggccaacattggaaccaccatgacagaggcaaaagataatgtgcctttaata
aaagatattctgaagagattggctattaaaagctcttacattcattgcgatgccgcgtta
gcaggaacatatctttccttattaggtcaaggctcttttgacttttcctatggtgccgat
agcattgccattagcgggcataaatttattggttcacctataccttgtggtgtggtgtta
gtcaaaaaatcatataaggatagaattggacgttccattccttatatcggaacactagac
acaactatctcaggctcccgtaatggaataacaccactctttttatggtataccattcaa
aagctgggaaggcagggattgttagaaagagcagaaaattgtctgaccgtagcagactat
gccttgcaacttttagaagaggctggaatcaatgcctggcgcaacgaaaatgctttaacc
gtggtatttcctcaacccaatgaacatatctgcaagaaatggcagctagcaagtgaaaat
gagatgtcgcatcttatctgtatgcctggcgtaacgaaatcacacattgatgcctttgta
aatgatttagttcagcagcaagatgaaaagtgcccagacttggaatcacaattaaactaa

DBGET integrated database retrieval system