KEGG   Flaviflexus sp. H23T48: EJ997_03830Help
Entry
EJ997_03830       CDS       T05772                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
flh  Flaviflexus sp. H23T48
Pathway
flh00030  Pentose phosphate pathway
flh00480  Glutathione metabolism
flh01100  Metabolic pathways
flh01110  Biosynthesis of secondary metabolites
flh01120  Microbial metabolism in diverse environments
flh01130  Biosynthesis of antibiotics
flh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:flh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EJ997_03830
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EJ997_03830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:flh04147]
    EJ997_03830
Enzymes [BR:flh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EJ997_03830
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EJ997_03830
Exosome [BR:flh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EJ997_03830
  Exosomal proteins of colorectal cancer cells
   EJ997_03830
  Exosomal proteins of bladder cancer cells
   EJ997_03830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AZQ76605
UniProt: A0A3Q9G6S5
Position
850132..851640
Genome map
AA seq 502 aa AA seqDB search
MTNPLRHPEDRRLPKIAGPCSLVLFGITGDLSDRKILPALYDLASHGLLPPSFAITGVAR
RLKVPLEELVEESIRNFAQTPFDQRVFDQFMGSISVVMGQYDEAKTFQDLRDKLDELDEQ
QGTGGNHAFYLAVPPDLFPTVLTQLGEAGLSEHPEGWRRVVIEKPFGHDLESSQELNDLV
TEVFAPEDVFRIDHYLGKETVQNLLSLRFSNELYEPLWNSDHIDHVQITMAENIGIGSRA
GYYDGVGSAKDVIQNHLLQLLALTAMEEPVSFSPHDLRQEKEKVLSALDFFGPVDQSAIR
AQYSEGWQGGKFVKAYLDEENIPADSVTDTYAALRLAVRTRRWQGVPFYVRTGKRLARRV
TEIAIVFKRPHFLPFEQRVTAGQSNNTLVIRIQPDEGVTFRFGVKVPGASFNVRDVTMDF
SYGHAFTEYTPEAYERLILDVLLGEPPLFPQQKEVEESWKILDRAFEYWDTLDTIDTYPP
GSWGPLSSDHMLARDGRAWRRA
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaatccgttaagacatccggaggatcgccggttgccgaagatcgcggggccctgt
agcctcgtgctcttcggcattaccggcgacctctcggaccgcaagatcctgccagcgctc
tacgatcttgcctcccacggtctcctgccgccctccttcgccattaccggcgtggcgcgg
cggctcaaggttccgttggaggaactggtcgaggagtccatccgcaactttgctcagaca
ccttttgatcagcgcgtcttcgaccagttcatgggttctatttccgtggtcatgggtcag
tacgacgaggccaagacgttccaggacctgcgcgacaagctggacgaactcgacgaacag
cagggaacgggtggcaaccacgcgttctatctagcagtgccgccggatctattccccacg
gtgctgacacagcttggcgaagctgggctgtcggagcacccggagggctggcggagggtc
gttatcgagaagccctttggtcacgacctcgagtcgtcccaggagcttaacgatctggtg
accgaggtatttgcgcccgaagatgtcttccgcattgatcattacctgggtaaggaaacg
gttcagaaccttctgagcctccggttctccaacgaactgtacgagccgctgtggaactcc
gaccacatcgaccacgtgcagatcacgatggcggagaacatcggtattggttcccgcgcc
ggctactacgacggcgtcggttcggccaaggacgttatccagaaccacctccttcagcta
ctcgcactgaccgccatggaggaacccgtttccttcagcccgcacgatctgcgccaggaa
aaggagaaggtgctgtccgcactcgacttctttggtccggtcgaccagtcggcaatccgc
gcccagtattcagagggctggcagggcggcaagttcgtcaaggcctacctggatgaagag
aacattcccgccgattcggtgaccgacacgtacgcggcccttcgcctagcggtgcgtacg
cgccgctggcagggcgtcccgttctatgttcgtaccggcaagcgtctcgcacgccgtgtc
accgagattgcgatcgtgttcaagcgtccccacttcctaccctttgagcagcgagtgacc
gcgggccagtccaacaacacgcttgtcatccggatccagccggatgaaggggtgaccttc
cgtttcggtgtcaaggttcccggtgcgtcgttcaatgttcgcgacgtgacgatggacttc
tcctacggtcacgcgttcaccgaatacaccccggaggcgtacgagcgactcatccttgac
gtgttgctgggcgagccaccgctcttcccacagcagaaggaagttgaggagtcctggaag
atcctggacagggccttcgagtattgggacacgctcgacacgatcgacacctatcccccg
ggttcctggggaccactgtcatcggaccacatgctggcccgtgacggtcgtgcttggagg
agagcgtag

DBGET integrated database retrieval system