KEGG   Flaviflexus sp. H23T48: EJ997_04120Help
Entry
EJ997_04120       CDS       T05772                                 

Gene name
argF
Definition
(GenBank) ornithine carbamoyltransferase
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
flh  Flaviflexus sp. H23T48
Pathway
flh00220  Arginine biosynthesis
flh01100  Metabolic pathways
flh01110  Biosynthesis of secondary metabolites
flh01130  Biosynthesis of antibiotics
flh01230  Biosynthesis of amino acids
Module
flh_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:flh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EJ997_04120 (argF)
Enzymes [BR:flh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     EJ997_04120 (argF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace OTCace_N
Motif
Other DBs
NCBI-ProteinID: AZQ76647
UniProt: A0A3Q9G730
Position
919602..920591
Genome map
AA seq 329 aa AA seqDB search
MTEHMTGRHFLKEADFTPAEWVSFVNLAGELKAERAAGREQQRLAGKAIALIFEKTSTRT
RAAFEVAAVHQGAATTYLDTSASQIGHKESIEDTARVLGRMYDAIEFRGDRQADVELLAE
SAGVPVYNGLTDDWHPTQMLADALTIREHVKKPFSDVISAYVGDARFNTGRSFLISAAML
GQDVRIIAPSGYEPPADVVELAESFAKDTGARITITDSLNAVEGADAISTDVWVSMGEAK
EVWSERIGALLPYQVNAELMKKAPDAVFMHCLPAFHDQETAVGREVYEAFNVTELEVTDE
VFRSPASVVFDQAENRLHTIKAVMVSTLS
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcatatgactggacgtcacttcctgaaggaagccgatttcactccggccgag
tgggtctcgtttgttaatcttgcgggtgaactcaaggctgaacgcgccgccggccgggag
caacagcgtcttgccggtaaggccattgctctcatttttgagaagacctccacaagaact
cgtgcagcctttgaggtcgctgcagttcatcagggcgcggccacgacgtacctggatacg
tccgcttcccagattggtcacaaggagtcaatcgaggacaccgctcgggtgcttggccgc
atgtacgacgcaatcgaattccgcggggatcggcaggccgatgtggagctgctagccgag
tccgccggtgtgcccgtctacaacgggctgaccgatgactggcatccaacgcagatgctg
gcagatgctctgacgatccgcgagcacgtgaagaagcctttttcagatgtcatctccgca
tacgttggcgacgctcggttcaatacgggacggtctttcctgatctccgcagcaatgctg
ggccaggacgtgaggatcatcgcgccgtcgggctatgaaccgcctgcggatgtggtggag
ctggccgaaagttttgcaaaggacacgggcgcccggatcacgatcaccgattccctcaac
gccgtcgaaggagccgatgccatctccaccgacgtgtgggtgtcgatgggagaggccaaa
gaggtgtggtcggaaagaattggcgcgcttcttccctaccaggtgaacgccgagctcatg
aagaaggcaccggacgcggtcttcatgcattgcctgcccgccttccacgatcaggaaacg
gccgttggccgcgaggtctacgaggcattcaatgtgaccgagctcgaggtaacggacgag
gtgttccggtcccccgcttctgtcgtttttgatcaggccgagaaccggctccacaccatc
aaggccgtcatggtgtcgactctgtcgtga

DBGET integrated database retrieval system