KEGG   Bernardetia litoralis: Fleli_0938Help
Entry
Fleli_0938        CDS       T02149                                 

Definition
(GenBank) poly(ADP-ribose) polymerase-like protein
  KO
K10798  poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
fli  Bernardetia litoralis
Pathway
fli03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:fli00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Fleli_0938
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fli03032]
    Fleli_0938
   03036 Chromosome and associated proteins [BR:fli03036]
    Fleli_0938
   03400 DNA repair and recombination proteins [BR:fli03400]
    Fleli_0938
Enzymes [BR:fli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     Fleli_0938
DNA replication proteins [BR:fli03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     Fleli_0938
Chromosome and associated proteins [BR:fli03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    Fleli_0938
DNA repair and recombination proteins [BR:fli03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     Fleli_0938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PARP WGR DUF4144 2Fe-2S_thioredx PBP3
Motif
Other DBs
NCBI-ProteinID: AFM03392
UniProt: I4AHF7
Position
1077560..1078948
Genome map
AA seq 462 aa AA seqDB search
MQTLSQTQTTTILKTAKLVMVTAHNNNKYYEMKQVSDDIFSVAYGRVGQRAAINEYSMYQ
WESKYREKVRKGYKDVTHLFREESENKSSKNDSVNSNYQNSLASWSAIKNGEVRELFRHL
TQYAQRSLSQNYEISAADVTIAQVEEAQNILNNLTKKVDFKSNKISKKDLENFDTIGFNA
LLLELYGIIPRKMESVQNYLLEYTVGKNISKQILQKARKILTNEQETLDVMRGEVELKLQ
QKKKDSFKTNATQHKKQDEKTLLDALGIEVNILDDKKTKDALQIKRIKKMMQNEVGKFVN
AYTIKDIAQEQIFAKNLKESKYRTTELFWHGSRNENWLSIFKTGLILRPTNALITGKMFG
YGLYFADKCRKALNYTSLKGSYWTGGNENKAFLAIYEVHTGRQLQLEKYENWCASLTYEK
LKKLNSEADSLFAKGGFDLLNNEFIVYKENQCTLRYLVEVHY
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacactttcacaaactcaaactactaccattctcaaaacagcaaaattagtaatg
gtaacagctcacaacaacaataaatattatgaaatgaagcaggtttctgatgatattttt
tcagttgcttatggaagagtgggacaacgagcagccataaatgaatattcaatgtatcaa
tgggaaagcaaatacagagaaaaagtacgaaaaggatacaaagatgtaacgcatttattt
agagaagaatctgaaaataaatcatcaaaaaatgattcggtcaattctaattatcaaaac
tctttagcttcttggtcggctatcaaaaatggagaagtgcgtgagctttttcgtcatctg
acacaatatgcacagcgttctttatcgcagaattatgaaatttcggctgctgatgttaca
atagcacaagtggaagaagcacaaaatattttaaacaatcttactaaaaaagtagatttt
aaatccaataaaataagcaaaaaagatttagaaaattttgatacaattggctttaatgcg
cttctattagaactttatggtatcattccacgcaaaatggaaagtgtgcaaaattatctt
ttagaatatacagtaggaaaaaatatctcaaaacagattctacaaaaagctagaaaaatt
ctgacaaacgaacaagaaacgctagatgtaatgcgtggcgaagtagaattgaaattgcaa
caaaaaaagaaagatagttttaaaacaaatgcaacacaacataaaaaacaagatgaaaaa
acacttttggatgcactcggaattgaagtaaatatcttagatgataaaaaaactaaagat
gctcttcaaatcaaacgtatcaaaaaaatgatgcaaaacgaagttggaaaatttgtaaac
gcttatacaataaaagatatagctcaagaacagatttttgctaaaaacttaaaagaaagt
aagtacagaacaacagaattattttggcatggaagccgaaatgaaaactggctttctatc
ttcaaaacaggtttgattttgcgtcctaccaatgcacttatcacagggaaaatgtttggt
tacggactttactttgctgataaatgccgaaaagcattgaattatacttcacttaaaggt
tcatattggacaggtgggaatgaaaataaagcctttttagccatttatgaagtacacaca
ggaagacaattacaactagaaaaatatgaaaattggtgtgctagtctgacttatgaaaaa
ctcaaaaaactaaattcagaagctgattcactttttgcaaaaggtggatttgatttatta
aataatgaatttattgtctataaagaaaatcaatgtactcttcgatatttagttgaagtg
cattactga

DBGET integrated database retrieval system