KEGG   Bernardetia litoralis: Fleli_3112Help
Entry
Fleli_3112        CDS       T02149                                 

Definition
(GenBank) nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
fli  Bernardetia litoralis
Pathway
fli00633  Nitrotoluene degradation
fli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fli00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Fleli_3112
Enzymes [BR:fli01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     Fleli_3112
  1.-  
   1.-.-  
    1.-.-.-  
     Fleli_3112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AFM05451
UniProt: I4ANB6
Position
complement(3715496..3716155)
Genome map
AA seq 219 aa AA seqDB search
MNLKETLNWRYTTKEFDPTKKISDSDMAQVKELLRMSPSSVNLQPWHFIIAETKEGKERI
AKGTQGFFSFNEPKVVNASAVILFCSRISADENYIQHLSATEEKDGRYPNEEIKKGVYGA
INTFADIHKYDLKDLQHWMEKQVYLNIGGFLLGVASLKIDATPMEGIDVKALDEEFGLRE
KGFTAITAVSIGYRAESDFNSTEKTPKSRLPKSEIFTEI
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaaagagacactaaactggagatacacaaccaaagaatttgacccaacaaaa
aaaatatctgattcggatatggcacaagttaaagagctgctaagaatgagtccatcaagt
gtaaatctacaaccttggcattttataattgcagaaaccaaagaaggaaaagaaagaatt
gcaaaaggaactcaaggcttttttagctttaatgaaccaaaagtagtaaatgcttctgct
gttatattattttgttctagaatttcggcagacgaaaattatatccaacacctttcagca
acagaagaaaaagatggaagataccctaatgaagaaatcaaaaaaggggtatatggagca
ataaatacttttgctgatattcacaaatacgatttaaaagaccttcaacattggatggaa
aaacaagtgtatttgaatattggtggatttttgttgggagtagcgagtctcaaaatagat
gctacaccaatggaaggaatagatgtaaaggccttagatgaagaatttggattaagagaa
aaaggttttactgccataacagctgtttcgattggttatagagcagaatctgattttaat
tctaccgaaaaaacaccaaaatcaagattacctaaaagcgaaatatttacagaaatataa

DBGET integrated database retrieval system