KEGG   Bernardetia litoralis: Fleli_3392Help
Entry
Fleli_3392        CDS       T02149                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
fli  Bernardetia litoralis
Pathway
fli00010  Glycolysis / Gluconeogenesis
fli00620  Pyruvate metabolism
fli00640  Propanoate metabolism
fli00680  Methane metabolism
fli01100  Metabolic pathways
fli01110  Biosynthesis of secondary metabolites
fli01120  Microbial metabolism in diverse environments
fli01130  Biosynthesis of antibiotics
fli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fleli_3392
   00620 Pyruvate metabolism
    Fleli_3392
   00640 Propanoate metabolism
    Fleli_3392
  Energy metabolism
   00680 Methane metabolism
    Fleli_3392
Enzymes [BR:fli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Fleli_3392
Lipid biosynthesis proteins [BR:fli01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Fleli_3392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFM05715
UniProt: I4AP30
Position
complement(4031302..4033197)
Genome map
AA seq 631 aa AA seqDB search
MRIRTLEDYTTAYRKSVETPERFWEEVAETFSWHKKWDTVLDYSFEDYSVKWFEGAKFNI
TENCLDRHLLTQGDKKALIWEPNSPEEEAIEFTYKQLHEKVCQFANVLKSNGIEKGDRVV
LYMPMIPELAIGVLACARLGAVHSVVFAGFSSSALADRINDAQAKIVLSSDGNFRGKRIF
DVKKVVDEALENCPSIEKQIVLKRTNSEVTMKEGRDIWWNEEAKKADTFCPATIIDAEDP
LFILYTSGSTGKPKGVVHHAGGYMVYTKYSFENVFQLRDDDVYWCTADIGWITGHSYIVY
APLLAGSTTLMFEGVPTFPDAGRFWEVVDKYKVSIFYTAPTAIRALQAKGLEFVNKYDLS
SIRVLGTVGEPINEEAWDWYHQHIGKGNCPIVDTWWQTETGGIMISNMAGVTPNKATFAT
LPLPGIQPVLLDAEGNEIEGNNVEGNLCIKYPWPSILRTTYGDHERCKQAYFSTYRGYYF
TGDGCKRDHDGMYRILGRVDDVINVSGHRMGTAEVEDAINQHEDVIESAIVGYPHEIKGQ
GIYAFVICDENSTKSKEELQKEILQTVSQHIGAIAKPEKIQIVSGLPKTRSGKIMRRILR
KIAEGDVSNLGDTSTLLDPEVVNEIKEGAGL
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgagaattagaactttagaagattacacaacagcctatagaaaaagcgtagaaacacct
gaacgtttttgggaagaagtagctgaaactttttcgtggcataagaaatgggatactgtt
ttagattatagctttgaagattattctgtaaaatggtttgaaggtgcaaaattcaatatt
acagagaattgtttggataggcatttacttacacaaggtgataaaaaagcattaatttgg
gagccaaatagcccagaagaagaagcgatagaatttacttataagcagttacatgaaaaa
gtatgtcagtttgctaatgttttgaaaagcaatggtatagaaaaaggtgatagagtggtt
ttatatatgcctatgattccagaattagctattggtgttttggcttgcgctcgtttggga
gctgttcattcagttgtttttgcaggtttttcttcttctgcattggctgaccgtattaat
gatgcacaagcaaaaatcgttttaagttcagatggaaattttagaggaaaaagaattttt
gatgtcaaaaaagtagttgatgaggctttagaaaattgtccttctatcgaaaaacaaatt
gttttgaaacgtaccaattcggaggttacaatgaaagaaggtagagatatttggtggaat
gaagaagctaaaaaagctgatacattttgtcctgctactattattgatgctgaagaccca
ttatttattctttatacttcaggctcaacaggcaagccaaaaggtgtagtacatcatgct
ggtggttatatggtttataccaaatatagttttgaaaatgtttttcagttgcgtgatgat
gatgtttattggtgtacggctgatattggttggattactggacattcatatattgtttat
gcacctcttttggctggttctactactctaatgtttgaaggtgttcctacttttccagat
gcagggcgtttttgggaagtggtagataaatataaagtttctattttttatactgcacca
acagctattcgtgcgctacaagcaaaaggacttgaatttgtaaataaatatgatttgtct
tctattcgtgtattgggaacagtaggcgaaccaataaatgaagaagcatgggattggtat
catcaacatattggaaaaggaaattgtccaattgtagatacttggtggcaaacagaaaca
ggtggaattatgatttcaaatatggctggagttacaccaaataaagctacctttgcaaca
ttaccacttccaggaattcagcctgttttattagatgctgaaggaaatgaaattgaagga
aacaatgtagaaggaaatttatgtataaaatatccttggccatcaattttgagaacaact
tatggagatcacgaacgttgtaaacaagcctatttttctacttatagagggtattatttt
acaggtgatggttgtaaaagagaccacgacggaatgtatcgtattttgggtagagtagat
gatgtaattaatgtttctggacacagaatgggaacggctgaggtagaagatgctatcaat
caacatgaagatgtaatcgaatcagcaattgtaggctatcctcacgaaataaaaggacag
ggaatttatgcctttgtaatctgtgatgaaaactctactaaatcaaaagaagaattacaa
aaagaaattttacaaactgtttctcaacatattggagcgattgccaaacccgaaaaaatt
caaattgtttcgggtcttccaaaaactcgctctggaaaaattatgcgtagaattttgagg
aaaattgctgaaggagatgtttctaatttgggagatacttctacacttcttgacccagaa
gtagtaaatgaaatcaaagagggtgcaggactttaa

DBGET integrated database retrieval system