KEGG   Flammeovirga sp. L12M1: EI427_09125Help
Entry
EI427_09125       CDS       T05771                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoyllysine-residue succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00020  Citrate cycle (TCA cycle)
fll00310  Lysine degradation
fll00380  Tryptophan metabolism
fll01100  Metabolic pathways
fll01110  Biosynthesis of secondary metabolites
fll01120  Microbial metabolism in diverse environments
fll01130  Biosynthesis of antibiotics
fll01200  Carbon metabolism
Module
fll_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fll_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EI427_09125 (odhB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    EI427_09125 (odhB)
   00380 Tryptophan metabolism
    EI427_09125 (odhB)
Enzymes [BR:fll01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EI427_09125 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AZQ62391
UniProt: A0A3S9P2H0
Position
1:complement(2288722..2290260)
Genome map
AA seq 512 aa AA seqDB search
MSLQMNVPAVGESITEVTVARWLKEDGEAVELDDVLCELESDKATFELVAESDGILKISP
EAQEDAVLEIGALLCTIEEGEGAPKKAASSTVAEPTVSAPSESPKATGQVLEMVVPTVGE
SITEVTIASWAKEDGDFVELDDLLCEIESDKATFELTAEESGILRIIAQEDETLEIGAPI
CKIEVMEGGAPQAAATPAVEATSAASTSSDKTYATGHASPAAAKILAEKGIDVATVKGTG
VDGRITKEDAEKAQKVAAPAPSKAKKETAAPSAPAPVAGERAQRREKMTALRKTVARRLV
SVKNETAMLTTFNEVDMKPVMDLRKKYKEMFKDKHEIGLGFMSFFTKAVTVALQEWPAVN
AFIDGNQLVYNDYADISIAVSAPKGLVVPVIRNAESLSLAAIEKEVRRLALKARDNKLTI
PEMEGGTFTITNGGVFGSMLSTPIINAPQSAILGMHNIVERPVAINGEVHIRPIMYVALS
YDHRIIDGRESVSFLKRVKELLEDPIRLLLDV
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcttacaaatgaatgttccagctgtcggtgaatctatcactgaagtaactgtcgca
agatggttaaaggaagatggagaagcagttgaattagatgatgtgctttgtgaacttgaa
tctgacaaagctactttcgagttagttgctgaaagtgacgggatattaaaaatatctcca
gaagcacaagaagatgcagtattagaaattggtgcattgctttgtacaattgaagaaggt
gagggagctcctaagaaagcagcttcttctacagtagcagaaccaacggtatctgctccc
tcagaaagtccaaaagcaactggtcaagttcttgaaatggttgttcctacagtaggtgaa
tctatcactgaggtaacaattgcatcttgggcaaaagaagatggagattttgttgagtta
gatgatctactttgcgaaattgaatctgataaagctacatttgaattgacagctgaagag
tctggtatcttaagaatcattgctcaagaagatgagactttagaaatcggtgctccaatt
tgtaaaattgaagtaatggaaggtggtgcgcctcaagctgctgctactcctgcagtagaa
gcaacaagtgcagcctcaacttcatcagacaaaacttatgcaactggacatgcgtctcca
gcggcagctaaaatattagcagaaaaaggtattgatgttgctactgtaaaaggtactggc
gttgatgggcgtattacaaaagaagatgcagaaaaagcacaaaaagtagcagctcctgca
ccatcaaaagctaagaaagaaacggcagctccttctgctccggctcctgttgcaggtgaa
agagctcaacgaagagagaaaatgacggctttacgtaagactgttgctcgtcgtttagtt
tctgtgaagaatgaaacagctatgttaactacctttaacgaggtagatatgaagccagta
atggaccttcgtaagaaatacaaagaaatgtttaaagacaagcatgaaattggattaggt
ttcatgtcattctttacaaaagcagtaactgtagcattacaagagtggcctgcagtaaat
gcatttattgatggaaatcaattagtatataatgattatgctgatatttctattgctgtg
tctgcacctaaagggttagttgttcctgtaatcagaaatgctgaatctttaagcttagca
gcaatcgagaaagaagtgagaagattagcacttaaagctcgtgataacaaactgactatt
ccagaaatggaaggaggtacatttactattacaaatggtggtgtatttggatcgatgttg
tcaacaccaattattaatgctccacaatcggctatcttaggtatgcataatatcgtagaa
cgtccagtagctattaatggtgaggttcatattcgtccaatcatgtatgttgctctttct
tatgatcaccgtattattgatggtcgtgaatcagtaagtttcttgaaacgagtgaaagaa
cttcttgaagatccaatcagattattattagacgtttaa

DBGET integrated database retrieval system