KEGG   Flammeovirga sp. L12M1: EI427_15045Help
Entry
EI427_15045       CDS       T05771                                 

Definition
(GenBank) low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00260  Glycine, serine and threonine metabolism
fll01100  Metabolic pathways
fll01110  Biosynthesis of secondary metabolites
fll01120  Microbial metabolism in diverse environments
fll01130  Biosynthesis of antibiotics
fll01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EI427_15045
Enzymes [BR:fll01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     EI427_15045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Pyridoxal_deC Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZQ63492
UniProt: A0A3Q9FS64
Position
1:complement(3725107..3726141)
Genome map
AA seq 344 aa AA seqDB search
MKKTLASDNYSGTTPEIIEAIAKANGAHQGSYGADESTDTAVAMFKKMFREDIDVYFTMN
GTGANVTALSSVCPSYGAVICSSVAHINVDECGAPEKFGGFKLLTVEKENGKLTPEDIAP
FMVNLGEQHWSQPKVISITQATEYGTVYTCAEIKAIADYAHENGLLLHVDGARISNAAVS
LGVSFKEMLLDTGVDFVSFGGTKNGLMFGEAVIFFNTAISENYKYVRKQGMQLLSKMRFI
SAQFEALFGTDLWERNAKHANKMAQKLASGLSKVAGVKITQEVKANGVFAIMPKEIIPAL
QEQSPFYVWDEQTHEVRLMCSFDTAEEEINAFLVKLDSLLLELA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacattagctagtgataattactcaggcacgactccagaaattatagaagca
attgcaaaagcaaatggagctcaccaaggttcttatggagcagacgagagtactgacact
gctgttgcaatgtttaaaaaaatgttcagagaagatattgatgtgtattttacaatgaat
ggtacaggagctaatgttactgcattatcatctgtttgtccatcatatggtgctgtaatc
tgttcttctgttgctcatattaatgttgatgaatgtggagctcctgaaaaatttggtggc
tttaaattactaacagtagaaaaagaaaatggtaaactaactccagaagatattgcacct
tttatggtgaatttaggcgagcaacattggtcgcaaccaaaagtaatttcaattactcaa
gctacagaatacggaacagtttatacttgtgcagaaattaaagctatagcagattatgcc
catgaaaatggtctgttattacatgttgatggagcaagaattagtaatgcagcggtatct
ttaggtgtttcttttaaagaaatgttactagatacaggagttgattttgtatcgtttgga
ggtacaaaaaatggtttgatgtttggcgaagcagtaattttctttaatacagctatttca
gaaaattataaatatgttcgtaaacaaggtatgcaattactgtctaaaatgcgttttata
agtgcacagtttgaggctttatttggtacagacctttgggaacgtaatgccaaacatgct
aataaaatggctcagaaattagcaagtggtttaagtaaagttgcaggagtaaaaataaca
caagaggttaaagcgaatggtgtttttgcaattatgcccaaagaaattattcctgcttta
caagaacaatctccattttatgtatgggatgaacaaactcacgaagtacgtttaatgtgt
tcttttgatacagctgaagaagagataaatgctttcttagtaaaattggatagtttgctt
ttagaattagcataa

DBGET integrated database retrieval system