KEGG   Flammeovirga sp. L12M1: EI427_25400Help
Entry
EI427_25400       CDS       T05771                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00620  Pyruvate metabolism
fll00630  Glyoxylate and dicarboxylate metabolism
fll01100  Metabolic pathways
fll01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EI427_25400
   00630 Glyoxylate and dicarboxylate metabolism
    EI427_25400
Enzymes [BR:fll01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     EI427_25400
    1.2.1.22  lactaldehyde dehydrogenase
     EI427_25400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AZQ65552
UniProt: A0A3S9PBX1
Position
2:complement(1360838..1362304)
Genome map
AA seq 488 aa AA seqDB search
MEELIITPQVKEYDLYINGEWVKASSGKTENVISPIDEDIVGIVQMGDEHEANLALSAAE
KAQKSWKKLPSIERANIMRKFAAEIRANKPYLSKLLTREQGKLLSVAEMEVEVTATFIEY
ACDWARHIEGDIMPSQNANEQIWINKIPRGVIVAITAWNFPLALAGRKIGPALVAGNAIV
VKPTQETPLATLELGYIAEKVGIPAGLINIVTGKGRVLGNALVASPITKMVTMTGSTPAG
QQIFKTASEHLAHVQLELGGKAPSIVFADADIDLAVESTFHSRFDNCGQVCTCNERMYVH
EDIYEEFMERFMAKVKAIKVGNPMEASTTMGPKVNASEIKNMEHLVAKSREEGATIAFGG
GKPQGLGFEKGFWFEPTVITDVTQDMTVVHEEAFGPILPVLKFKSFDEVITYANDCEFGL
AAMVYTKDINTIMKCNDELEFGEIYVNRGHGEQHQGFHNGYKLSGTGGEDGKYGFEQYME
KKTFYVKY
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggaagaactaattataacaccccaagtaaaagaatacgatttatacataaatggagaa
tgggttaaggcatcttctggaaaaacagaaaatgtaattagtcctatcgacgaagatatt
gttggtatagtacaaatgggtgatgagcacgaagctaatttagctttgtctgcagccgaa
aaagcacaaaaaagttggaaaaaattaccttctattgagcgtgcaaatattatgcgaaag
tttgctgctgaaataagagctaacaagccttatttatcaaagttgttaactagagaacaa
gggaaattattgtctgttgcagaaatggaagtagaagttacagcaacttttattgagtat
gcatgcgattgggcaagacacattgagggagatattatgccttctcaaaatgcaaacgaa
caaatatggatcaataagattccacgtggtgtgatagtagcgataacagcatggaatttc
cctcttgctttagcaggtcgaaaaattggaccggctttagtagcggggaacgccattgtt
gttaagccaacgcaagaaacacctcttgcaactttagaactaggctacattgcggaaaaa
gtaggtatacctgctggccttattaatattgtaactggtaaaggtagagtgttagggaat
gcgttagttgcatcgcctattacaaagatggtaacaatgacaggttctacacctgcggga
caacaaatctttaaaacagcctctgaacatcttgcacatgtacaattagaattgggcgga
aaagcaccttctattgtatttgcagatgcagatattgatttagcagtagaaagtactttt
cattctagatttgataattgcggtcaggtatgtacatgtaatgaaagaatgtacgtgcat
gaagatatttacgaggaatttatggagcgtttcatggccaaagtgaaggcaataaaagta
ggtaaccctatggaagcttctactactatgggaccaaaggtaaatgcttctgaaattaag
aatatggaacaccttgttgctaaaagtagagaagaaggagctacaattgcttttggtgga
gggaaacctcaaggattaggttttgaaaaaggtttttggtttgaaccaacggtaattaca
gatgtaactcaagacatgactgtagtacatgaagaagcatttggacctattcttcctgtc
ttaaaatttaaatcttttgacgaggtaattacttatgcgaatgattgtgagtttggttta
gcagcaatggtttataccaaagacatcaatacaattatgaagtgtaatgatgagttagaa
tttggggagatttatgtaaatagagggcatggtgaacaacatcaaggattccataatggc
tacaaattaagtggtactggtggagaagatggaaaatatgggtttgagcaatacatggag
aagaaaacattctatgtaaagtactaa

DBGET integrated database retrieval system