KEGG   Flammeovirga sp. L12M1: EI427_25510Help
Entry
EI427_25510       CDS       T05771                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
fll  Flammeovirga sp. L12M1
Pathway
fll00511  Other glycan degradation
fll00600  Sphingolipid metabolism
fll01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fll00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    EI427_25510
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EI427_25510
Enzymes [BR:fll01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     EI427_25510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C
Motif
Other DBs
NCBI-ProteinID: AZQ65573
UniProt: A0A3S9PBS6
Position
2:complement(1398325..1399815)
Genome map
AA seq 496 aa AA seqDB search
MKMKFNKLIGGILTVLAVSSCAQKQASTETTTSKIETQMPALELSKVDVVTTADNSQLRL
AKTGEFKFGKATQPREDQVSVFVNPNKSFQTFLGIGGAITDASAEVWAKLPKDKQDELIS
AYYTDNGIGYSLLRTTIHSCDFSPYSYTYVEEGDKELKTFSIKHDLEFRIPMMKRAIAAS
GGELTTYASPWSPPAFMKGKKDMLKGGSLLPEFYQSWANYYVKFIEEYEKQGIPMWGVTI
QNEPMATQTWESCIYSAEQERDFLKNFLGPAFENNGMADKNIVVWDHNRDLISHRANVIF
EDPEAAKYAWGIGMHWYETWTGGEAMQINLDNIQESFPDKNILFTEGCQEGFDAKHYQRW
SNGERYGRNMINDFNQGTVGWTDWNILLDQTGGPNHVNNLCFSPIHADVNKGELIYTPSY
YYIGHFSKYIKPGAKRISTSTSRSTLISTSFRNTDGSIATVVMNQTNEAISYNFIVGDKE
VNAEIPAHAIQTLLYK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgaaattcaataaacttatcggtggtatacttactgttttagcagtgagttca
tgtgcacaaaagcaagcatcaacagagacaacgacttctaaaatagaaactcagatgcct
gcattagaattatctaaagtagacgtagttacaactgcagataattcacaattgagatta
gctaaaactggtgaatttaaatttggaaaagcaactcaaccaagagaagatcaagtttca
gtttttgtcaatccgaataagtcattccaaacatttttaggaattggtggagccatcact
gatgcttctgcagaagtttgggcaaaattaccaaaagataaacaagatgaattaattagt
gcttactacacagataatggtattggttactcattattaagaacaacaattcatagttgt
gatttctctccttattcttatacgtatgtagaagagggcgataaagaattaaaaacattc
tcaattaaacatgatttggaattccgaattccaatgatgaaaagagcaattgctgcaagt
ggtggtgaattaactacttatgcatctccttggtctcctccagcatttatgaaagggaaa
aaagatatgcttaaaggaggttctttattacctgagttctatcaatcttgggctaattat
tatgtaaagttcatagaggaatatgaaaaacaaggtattccaatgtggggtgtaacaatc
caaaatgaaccaatggctacgcaaacttgggagtcttgtatttattcagcagaacaagag
cgtgatttcttaaagaatttcttagggcctgcatttgaaaataatggaatggcagataaa
aatattgtagtatgggatcataaccgtgatttaatttctcatagagctaacgttattttc
gaagatcctgaagcagcgaaatatgcatggggtattggaatgcattggtatgaaacatgg
actggtggtgaagcaatgcaaattaatttagataatattcaagaatcttttcctgataaa
aacattttatttacagaaggatgtcaagaagggtttgatgcaaagcattaccaaagatgg
tctaatggagagcgttacggtagaaatatgattaatgactttaatcaaggtacagttggt
tggacagattggaatattttactagatcaaacaggtggtccaaatcatgtaaataattta
tgtttttctccaatccatgcagatgttaataaaggggagttaatttacacaccttcatat
tattacatcggacatttttctaaatatattaagccaggtgctaagagaatttctacatct
acaagccgtagtacattaattagtacttcgttcagaaatacagatggatctattgctact
gttgtaatgaaccaaacaaacgaagcaattagctacaactttattgttggcgacaaagaa
gtgaatgcagaaattcctgcacatgcaattcagacattattatataaatag

DBGET integrated database retrieval system