KEGG   Flammeovirga sp. MY04: MY04_1296Help
Entry
MY04_1296         CDS       T04442                                 

Definition
(GenBank) Acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00430  Taurine and hypotaurine metabolism
flm00620  Pyruvate metabolism
flm00640  Propanoate metabolism
flm00680  Methane metabolism
flm01100  Metabolic pathways
flm01120  Microbial metabolism in diverse environments
flm01200  Carbon metabolism
Module
flm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MY04_1296
   00640 Propanoate metabolism
    MY04_1296
  09102 Energy metabolism
   00680 Methane metabolism
    MY04_1296
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    MY04_1296
Enzymes [BR:flm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     MY04_1296
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase Lyase_8_C DSPc
Motif
Other DBs
NCBI-ProteinID: ANQ48673
UniProt: A0A1B1FRA5
Position
1:1588792..1590000
Genome map
AA seq 402 aa AA seqDB search
MKILVINAGSSSLKYQLFEMDGTQVLCSGIVERIGLENGIITHKTFDAEGNATKTKKELP
IPNHNVGLTEVVALLTDADNGVIQNTDDIQAVGHRVVHGGEFFSDTMVITEEVEAKIKEC
FQLAPLHNPANLQGIEDCKAIFTKATQVAVFDTAFHQTMPGKAFRYAVPTELYEKHGVRV
YGMHGTSHKYVSKAAIDHLGLAGKDSKIITVHLGNGCSMSAVRNGECIDTSMGFSPLDGL
MMGTRSGDIDPAVVFYLMDKLNMKSEEVYDLLNKKSGMLGVTGDSDMRDIEDRFAAGDEV
AILATHMYTYRIKKYIGAYMAALNGADAICFTAGVGENDHGIRHYSSIELEGLGIELDAE
KNKNLRASDIEEISTPNSKVKVLIVPTNEELEIAQQTLAVLN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccttgttattaatgcaggtagttcatcgctaaaatatcaattatttgagatg
gacggtacacaagtgttgtgttcaggtatcgtagaaagaatcggtcttgaaaatggaatt
atcactcataaaactttcgatgctgaaggtaatgctactaaaacaaaaaaagaattacca
atcccaaatcataacgttggtttaactgaagtggtggcattgttgacggatgctgacaac
ggagtaatccaaaatacagatgatatccaagctgttggtcaccgtgttgttcatggcggt
gaattctttagtgatacaatggtgattactgaagaggtggaagcaaaaatcaaagaatgt
ttccaattggctcctttgcataaccctgccaacctacaaggaattgaagattgtaaagcc
atctttacaaaagcaactcaagtagctgtttttgatactgcattccatcaaactatgcca
ggtaaggctttccgttatgctgttccaacagaattatatgaaaagcatggtgttcgtgtt
tatggtatgcacggtacttctcataaatacgtatctaaagcagctatcgaccatttaggt
ttagctggtaaggattctaaaatcattacagttcacttaggtaacggttgttcaatgtca
gctgttcgcaatggtgagtgtattgatacatcaatgggcttctctcctcttgatggttta
atgatgggtactcgttctggagatattgacccggcagtagttttctatttaatggataaa
ttaaatatgaaatctgaagaggtgtatgacctattgaataaaaaatcaggtatgttaggt
gtgacaggtgattctgatatgagagatatcgaagatcgtttcgctgcaggtgatgaagtg
gcaatccttgctactcacatgtacacttacagaatcaaaaaatatattggtgcttatatg
gctgccttgaacggtgctgacgctatctgtttcactgcaggtgttggtgaaaacgaccac
ggtattcgtcactattcatcaatcgaattagaaggtttaggaatcgaattagatgctgaa
aagaacaaaaacttaagagcttctgatattgaagaaatttctactccaaactcaaaagta
aaagtacttatcgtacctacaaatgaggaattagaaattgctcaacaaactttggcagtt
ttaaactaa

DBGET integrated database retrieval system