KEGG   Flammeovirga sp. MY04: MY04_1344Help
Entry
MY04_1344         CDS       T04442                                 

Definition
(GenBank) Malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00620  Pyruvate metabolism
flm00630  Glyoxylate and dicarboxylate metabolism
flm01100  Metabolic pathways
flm01110  Biosynthesis of secondary metabolites
flm01120  Microbial metabolism in diverse environments
flm01200  Carbon metabolism
Module
flm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MY04_1344
   00630 Glyoxylate and dicarboxylate metabolism
    MY04_1344
Enzymes [BR:flm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MY04_1344
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: ANQ48720
UniProt: A0A1B1FRI4
Position
1:1655600..1657204
Genome map
AA seq 534 aa AA seqDB search
MNLKSTLTEKTIDIMGDMMMDHEAILTDEALNFVAALHKRFNKRRLALLEARTKRQEELD
SGKLPNFLAATAYIRNSEWTVAEVKKDIQDRRVEITGPVDRKMIINALNSGANVFMADFE
DANSPTWTNCMEGQQNLKDAVNKTISFTHPVTAKVYSLNNEIATLFVRPRGWHLEEKHLE
YDGKACSGSLVDFGLYFFHNAKTLLENGSAPYFYLPKIESHLEARLWNDIFIYAQEYIDI
PQGSIKATVLIETILAAFEMDEILYALKEHSAGLNCGRWDYIFSYIKKLRNIPGYTLPDR
AKVTMNVHFMKSYCELLIQTCHKRNAFAMGGMAAQIPIKDDQKANQKAIDKVAKDKTREA
LAGHDGTWVAHPGLVSVAREVFDRYMGAPNNIKKPVEFKKITAKDLLKVPEGDITLKGLR
TNIDVGIQYISKWLDGQGAVPIYNLMEDAATAEISRSQVWQWIKNNAKTDDGQLIDEQLY
HQVADDVMKHFRTIMGEEKFNQSKLQKAKDIFDQLVLTDEFVEFLTLPAYQQID
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttaagtctactttaaccgagaaaaccatcgatatcatgggcgatatgatgatg
gatcacgaagcaatcttaactgatgaagctttgaattttgttgcagccttacataaaagg
ttcaataaaagaagacttgctcttttagaagcaagaacaaaaagacaagaggaattggat
agtggaaaacttcctaacttccttgcagctacagcctatattagaaatagtgaatggact
gttgctgaggtaaaaaaggacattcaagacagaagagtcgaaattactggtccggttgat
cgaaaaatgatcatcaatgccttgaactctggtgcaaatgtttttatggctgattttgag
gatgctaattctccgacttggacaaattgtatggagggacagcaaaacttgaaagatgct
gtaaacaaaacaattagttttacgcatccggtcacagctaaggtatattctctaaacaat
gaaattgctacgcttttcgttagacctagaggatggcatttagaagaaaaacatctagag
tacgatggtaaagcttgctcagggtcacttgttgattttgggttgtacttcttccataat
gcaaaaaccttacttgaaaatggaagtgctccttatttttatctacctaagattgaaagt
catttagaggcaagactttggaatgacatctttatttacgctcaagaatatattgatatt
ccacaaggctctattaaagctactgtattgattgagactattttagcggcttttgaaatg
gatgaaatcctgtacgcgctaaaagaacattcagcaggattgaattgtggtcgttgggat
tatattttctcatatatcaaaaaattgagaaatattccagggtatacccttcccgataga
gcgaaggtgacaatgaacgttcactttatgaaatcatactgtgaattgttaatccaaaca
tgccacaaacgtaatgcttttgctatgggaggaatggccgctcaaattcctatcaaggat
gatcaaaaagccaatcaaaaggcaattgacaaagttgcgaaagacaaaactcgtgaagcc
ttggcagggcatgatggtacttgggtggctcacccaggattagtttctgtagctagagag
gtattcgatagatatatgggagcacctaataacatcaagaagcctgttgaatttaagaaa
atcacagccaaggatttattaaaggtacctgaaggtgatatcacattaaaaggcttgaga
actaatattgatgtaggaatccagtacatcagtaaatggttagacggccaaggtgcagtt
ccgatctataatctgatggaggacgctgctactgcagaaatttctagatctcaggtttgg
caatggataaaaaacaatgcgaagacggatgatggacaattgattgatgaacaattgtat
catcaagtagctgacgatgtgatgaagcatttcagaaccattatgggagaagaaaaattc
aaccaaagtaagttgcaaaaagcaaaagacatatttgatcaattggtattaacagatgaa
ttcgttgaattcttaacgttacctgcttatcagcaaattgattaa

DBGET integrated database retrieval system