KEGG   Flammeovirga sp. MY04: MY04_2387Help
Entry
MY04_2387         CDS       T04442                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00620  Pyruvate metabolism
flm00630  Glyoxylate and dicarboxylate metabolism
flm01100  Metabolic pathways
flm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MY04_2387
   00630 Glyoxylate and dicarboxylate metabolism
    MY04_2387
Enzymes [BR:flm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     MY04_2387
    1.2.1.22  lactaldehyde dehydrogenase
     MY04_2387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: ANQ49759
UniProt: A0A1B1FUD2
Position
1:complement(2964664..2966127)
Genome map
AA seq 487 aa AA seqDB search
MNTTTTQDIKVYPCYINGEWVETSKGEYIDVENPANNQVFARVYCSTETEVQLALESADK
AQFAWQMLPANDRANYLYAITEKLNEERDHFARLLVMEQGKTLAEAYGEVDDTIRYINYS
AEAGRRIEGSIFPSDMANEQLSIHKVPYGVTVGLMAFNYPLALIGRKIGPALITGNTMVI
KPSELTPITASEFCRLVHEAGLPKGVISMVMGWGHTVGTQLIESPITKLVSMTGSTRAGQ
AIYKTASQNVAGLVLELGGKAPFIVMDDAEIDKAVEAAVVARYANCGQVCICNEMLFVHE
KIADEFTEKVIERTKQITVGDPMTQVNMGPNVSTKGLSRVHDLVMENISQGAELVLGGKR
PEGKYFEEGNWYEPTILTNVKSDDATLRNELFGPVLPIMKVSGYEEAKSLLNDREEGLSA
YLFTQNHKTIMKSINEFQVGTIFINKGIVGYIQGFHSGHKTSGIGGEDGIYGIEQYLQKR
AIYMNYE
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgacaacaacacaagacattaaagtatacccatgttacatcaatggagagtgg
gtagaaacttcaaaaggagagtatatagatgtagaaaacccagccaataatcaggtattt
gcaagagtgtattgcagtacggaaacggaagtgcaattggcattagaaagtgcagataaa
gcacaatttgcttggcaaatgttgccagcaaacgatagagcaaattacttatatgcaatt
actgaaaagttaaacgaggaaagagatcattttgctcgtttattggtgatggaacaaggg
aaaacattggcagaagcgtatggagaagtagatgataccatccgatatatcaattactca
gccgaagcaggtagaaggatagaaggaagtatttttccatctgatatggccaacgaacaa
ctcagtattcataaagtaccttatggagtgactgtcggtttaatggcatttaattatccg
ttagcactcattggtagaaaaattggtccagctttaattactggaaatacgatggtgata
aagccttctgagttaacaccaattacagcatcagagttttgtcgtttggttcatgaggca
ggtttacctaaaggggtaattagtatggtgatgggttggggacataccgtaggtactcaa
cttatcgaaagtccaattaccaaactcgtttccatgacgggaagcacaagagcagggcaa
gcgatctataaaacagcttctcaaaatgtagcaggtcttgtattggaattaggaggaaag
gctccatttattgtgatggatgatgccgaaattgataaagccgtagaagctgcagtagtg
gcacgatatgccaattgtggacaagtatgtatttgtaacgaaatgcttttcgttcatgaa
aaaatagccgatgaatttacagagaaagtcattgaacgtacgaaacaaataacggtggga
gatccaatgactcaggtaaatatgggaccaaatgtaagcactaaaggtttatcaagagta
catgatttagtgatggaaaatatctcccaaggagccgaattggtactaggagggaaacga
ccagaagggaagtattttgaagaaggaaactggtatgagccgactatcttgaccaatgtg
aaaagtgatgatgcgactctaaggaatgaattgtttggacctgtacttccaatcatgaaa
gtatcgggatatgaagaagcaaaatctttattaaatgatagagaagaaggattatcagct
tatttgtttactcaaaaccataaaacgataatgaaatcgatcaatgagtttcaggttgga
accatcttcatcaacaaaggtattgtaggctacatacaaggtttccactctggacataaa
acaagtggaatcggaggagaagatggcatctatggtatcgaacaatatctccaaaagcga
gccatctacatgaactacgaataa

DBGET integrated database retrieval system