KEGG   Flammeovirga sp. MY04: MY04_2772Help
Entry
MY04_2772         CDS       T04442                                 

Definition
(GenBank) Aromatic amino acid beta-eliminating lyase/threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00260  Glycine, serine and threonine metabolism
flm01100  Metabolic pathways
flm01110  Biosynthesis of secondary metabolites
flm01120  Microbial metabolism in diverse environments
flm01130  Biosynthesis of antibiotics
flm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MY04_2772
Enzymes [BR:flm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     MY04_2772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: ANQ50140
UniProt: A0A1B1FVM7
Position
1:complement(3481770..3482804)
Genome map
AA seq 344 aa AA seqDB search
MKKTLASDNYAGTSPEIIEAIAKVSNGHQGAYGADDATKEAIKMFKRLLKEDIDVFFTMN
GTGANVTALSSVCPSYGAVITSSVAHINVDECGAPEKFGGFKILTIEKEDGKISPEDISP
FLVNLGEQHWSQPKVVSITQATEYGTVYTCEEIKAIADFAHQNNLLLHVDGARISNAAVS
IGATFKEMLVDTGVDFISFGGTKNGLMFGEAVIFLNTSLSENYKYLRKQGMQLLSKMRFI
SAQFVALFDGDLWKKNAEHANKMAQLLAEGLQKAEGAKVTQKVQANGVFAILDPKVIPIL
QEQSPFYVWNEQTHEVRLMCSFDTTEEEINQFITTLEKYQVVEA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagacattagcaagtgataattatgcgggaacatctcctgaaataattgaggcg
atagcaaaagtaagtaatggacatcaaggagcctatggagcagacgatgctacaaaagaa
gctatcaagatgttcaaaagacttttaaaagaggatattgatgttttctttactatgaat
ggaacaggagcgaatgttactgctttaagttctgtttgtccttcttatggtgctgttatt
acttctagtgtagctcacattaatgttgatgagtgtggtgctccagaaaagtttggtggt
tttaaaatcctaaccatagagaaagaagacggtaaaatatcacctgaagatatttctcct
tttctagtgaatttgggagagcaacattggtcgcaacccaaagtagtttccattacacaa
gctacggagtatggtacggtctacacatgcgaagaaattaaagcaatcgctgattttgca
catcaaaataatcttcttttacatgttgatggagcaagaattagtaatgcagccgtttct
ataggagcaacatttaaagaaatgttagtagatactggtgttgattttatttcattcgga
ggaacaaagaacggattaatgtttggtgaagctgtaattttcttgaatacttctttatca
gaaaattacaaatacctcagaaaacaaggaatgcaacttttatcaaaaatgcgtttcata
tctgctcagtttgttgctttatttgatggagatctttggaaaaagaatgctgaacatgcg
aataagatggctcagttgttagcagagggacttcaaaaagcagaaggggctaaggtgact
caaaaagtacaagccaatggcgtatttgctattctcgaccctaaagtaattccaatttta
caagaacaatctcccttttatgtttggaatgaacagacgcatgaagtacggttaatgtgt
tcttttgatacgacagaagaagagatcaatcagtttattactaccttggaaaaataccaa
gtagtagaagcatag

DBGET integrated database retrieval system