KEGG   Flammeovirga sp. MY04: MY04_3468Help
Entry
MY04_3468         CDS       T04442                                 

Definition
(GenBank) Phosphoglycerate/bisphosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
flm  Flammeovirga sp. MY04
Pathway
flm00860  Porphyrin and chlorophyll metabolism
flm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:flm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MY04_3468
Enzymes [BR:flm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     MY04_3468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ANQ50821
UniProt: A0A1B1FXF3
Position
1:complement(4385782..4386348)
Genome map
AA seq 188 aa AA seqDB search
MSMTIYLVRHTTPDVEASKILYGQTDLDLDQNFDVEAEEVKQTIGDDGLSSIFYSPLKRC
KQLAKKLPADIHIEDDRLLEINYGDWEMKTFHELGADLKEWAKYFDHKAAPNGESLMDVK
SRLCDFWQDNIQYDEGKSIAIVTHGVVMRVILCYLLEMPLKNIFRIQFGFGKVIKIELQE
SGRTRVNI
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgacgatctatcttgttagacatactacccctgatgtcgaagcaagcaaaatt
ttatatggacaaacggatttggatttagatcaaaattttgatgttgaagccgaagaagta
aaacaaactattggtgatgatggactatccagtattttttatagtccactaaaaaggtgt
aaacaattagcaaagaaactacctgctgatattcacatcgaagatgatcgtttgctagaa
attaattatggtgattgggagatgaaaaccttccacgaattaggggcagacttaaaagag
tgggccaaatattttgatcataaggcggctccaaatggcgaatctttgatggatgtaaaa
tcaagattatgcgatttttggcaggataatattcaatatgatgaagggaaaagcattgct
attgtcacacacggtgttgtaatgcgagtaattttatgttaccttctcgaaatgccttta
aaaaatatcttccgaattcagtttgggtttggtaaggtgattaagattgaactacaggaa
tctggtagaactagagtaaacatataa

DBGET integrated database retrieval system