KEGG   Filimonas lacunae: FLA_4634Help
Entry
FLA_4634          CDS       T05172                                 

Definition
(GenBank) succinyl-CoA:3-ketoacid-coenzyme A transferase subunit B
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
fln  Filimonas lacunae
Pathway
fln00072  Synthesis and degradation of ketone bodies
fln00280  Valine, leucine and isoleucine degradation
fln00650  Butanoate metabolism
fln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FLA_4634
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    FLA_4634
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FLA_4634
Enzymes [BR:fln01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     FLA_4634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: BAV08588
UniProt: A0A173MMI0
Position
complement(5666316..5666972)
Genome map
AA seq 218 aa AA seqDB search
MALDKFGIAKRIARELEDGMYVNLGIGIPTLVANYIPEGITVILQSENGILGTGPYPVEE
EVDADLINAGKETVTLLPGGAFFDSAESFGMIRAGKIDLTVLGAMEVSDQGDIANWKIPG
KMVKGMGGAMDLVASARNIIVAMQHTNPKGESKLLPACTLPLTGVACVKKIVTELAVLDV
TSEGFLLREFAPGVTIEEIQQKTLGRLVVGEDVKEMFC
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcacttgataagtttggcatagcaaaacgtatagcccgggagctagaagacggcatg
tacgtaaacttaggtattggtattcctacattagtagctaattatattccggaaggcatt
accgttattttacaaagtgaaaacggtattctgggcaccgggccttacccggtagaggaa
gaagtagatgctgatctgatcaatgcaggtaaagaaacggtgaccttattgcctggcggt
gcgttttttgacagtgccgaaagctttggcatgatacgcgcaggtaaaatagatcttacc
gtattaggggctatggaagtgagcgaccagggggatattgccaactggaaaatacccggt
aaaatggtaaaaggaatggggggagctatggacctggtagccagtgcacgtaacattata
gtggccatgcagcatactaatcctaaaggagaatccaaattgctgccagcctgtacgttg
cctttaaccggtgtagcttgtgtaaaaaagattgttacggaactggctgtgctggatgtt
acatctgaaggatttttattgcgtgagtttgcgccaggggtaacaatagaagagattcag
caaaaaacactgggacgtttagtggtaggggaagatgtgaaagaaatgttttgctga

DBGET integrated database retrieval system