KEGG   Filimonas lacunae: FLA_5087Help
Entry
FLA_5087          CDS       T05172                                 

Definition
(GenBank) coproporphyrinogen III oxidase, oxygen-independent
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
fln  Filimonas lacunae
Pathway
fln00860  Porphyrin and chlorophyll metabolism
fln01100  Metabolic pathways
fln01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fln00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FLA_5087
Enzymes [BR:fln01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     FLA_5087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM AAA_22 HemN_C PC4
Motif
Other DBs
NCBI-ProteinID: BAV09040
UniProt: A0A173MNL6
Position
6263179..6264546
Genome map
AA seq 455 aa AA seqDB search
MSVPVALLHQYNIPVPRYTSYPTVPVWPADIDYDRWIVTAGEQLTSHAASKGISLYIHLP
FCESLCTYCGCNKKITTNHNVEVPYIDAVLKEWELYVQQLPQKPVIKELHLGGGTPTFFS
PENLERLLSGIFELGTLAPTPEMSFEGHPGNTTAEHLLTFYNLGFRRVSFGVQDLDPQVQ
HVINRIQPFEQLEEVTRLARNIGYQSVNFDLIYGLPLQTIDSITNTINRSLELHPDRIAF
YSYAHVPWTSKAQRLFSEADLPTAAVKLLLYQQGKRIFAEHGYQDIGMDHFAIPGDALYK
AQQTGMLHRNFMGYTTQHTAVLVGLGVSAISDIGIAYAQNEKTIHDYYQRLENNELPVAK
GIFLTEEDRLFKQYILDISCRGKTTFVNKYREQLEQYSYPELDQLEADDLIYRNSNGIKV
TDTGKNFIRNICRAFDLHLLRNGESGDRPMFSKAV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtctgttccagttgccttgttacatcaatacaatattcctgttccccggtataccagc
taccctaccgtgcctgtttggccggccgatatcgattatgatagatggatagttaccgcc
ggggaacaacttaccagccatgccgcttctaaaggtattagcctgtatatacaccttcct
ttttgcgagtcgctttgcacctactgtggttgcaacaaaaaaatcaccaccaaccacaac
gtagaagtcccctacattgatgccgtgttaaaagagtgggaactgtatgtgcagcaacta
ccccaaaagccggtgattaaagagctgcatttgggtggcggtacccccactttcttttcg
cccgaaaacttagagcgcctgttaagcggcatttttgagctgggcacattggcccctact
cccgaaatgagttttgagggtcaccctggcaataccactgccgaacatttattgactttt
tataacctgggttttagaagagtaagctttggcgtacaggatctggacccacaagtgcaa
cacgtcattaaccgcatacagccttttgaacaactggaagaagtaaccaggctggcccgc
aacattggctaccagagcgttaatttcgatttgatctatggcctgcccctgcaaaccata
gacagcattaccaacaccattaaccgctccctggaactgcatcctgatcgtattgctttt
tacagctatgcacatgtgccgtggaccagcaaagcccagcgccttttttctgaagctgat
ttacctaccgctgccgtaaaactgctgttataccagcaaggcaaaagaatatttgccgaa
cacggttaccaggatattggtatggatcattttgccattccgggtgatgccttgtataaa
gcacaacaaaccggcatgctacaccggaactttatgggctacaccacgcagcacaccgcc
gtgctggtgggcctgggtgtatcggccatcagcgacataggcatagcctacgcacaaaac
gaaaaaaccattcacgattattaccaacgcctggagaataacgagctacccgtagcaaaa
ggcattttcttaaccgaagaagaccgtctgtttaaacaatacatactggacatcagctgc
cgcggcaaaaccaccttcgtaaacaaataccgcgaacaactggaacaatacagctaccct
gaattagaccagctggaagccgatgatcttatttaccgcaattctaatggcataaaagta
accgacaccggtaagaattttattcgcaacatctgtcgtgcattcgacctgcatttgttg
cgtaacggtgaaagtggcgacaggcccatgtttagtaaagcagtgtaa

DBGET integrated database retrieval system