KEGG   Candidatus Fluviicola riflensis: CHH17_01445Help
Entry
CHH17_01445       CDS       T05019                                 

Definition
(GenBank) N-acetyltransferase
  KO
K13018  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase [EC:2.3.1.201]
Organism
flu  Candidatus Fluviicola riflensis
Pathway
flu00520  Amino sugar and nucleotide sugar metabolism
flu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:flu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CHH17_01445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:flu01005]
    CHH17_01445
Enzymes [BR:flu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.201  UDP-2-acetamido-3-amino-2,3-dideoxy-glucuronate N-acetyltransferase
     CHH17_01445
Lipopolysaccharide biosynthesis proteins [BR:flu01005]
 Unusual sugar
  CHH17_01445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexapep Hexapep_2 DUF4954
Motif
Other DBs
NCBI-ProteinID: ASS47441
Position
358752..359327
Genome map
AA seq 191 aa AA seqDB search
MGHFAHETAVVDEGCTIGEGTKIWHFSHIMPNCTIGERCNIGQNVVVSPEVILGNNVKVQ
NNVSIYTGVICEDDVFLGPSMVFTNVMNPRSAVNRRDQYSQTIVKKGASIGANATIVCGN
DIGEFAFIGAGSVVTKEVPAYALVVGNPARRIGWMSAYGHRLTFDEQGYATCPESNEKYH
LSDGKVQKINA
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggggcattttgcacacgaaactgcggtagtcgatgaaggttgtaccattggtgaaggc
accaaaatctggcacttttcacacatcatgcccaattgtacgattggtgaacgctgtaat
atcggtcagaacgtagtggtttcaccggaagtgattttgggcaacaacgtgaaagttcag
aacaacgtgtctatttacaccggcgtgatctgtgaagacgatgttttccttggcccgtcg
atggtgtttaccaacgtgatgaacccgcgcagtgcggtcaatcgccgtgatcagtattcc
caaacgattgtgaaaaaaggtgcttcaatcggtgcaaacgcaaccattgtttgcggaaac
gacattggtgaatttgcctttatcggtgccggatcagtagtcacaaaggaagtgccggcc
tatgcattggtagtaggaaatcctgctcgccggataggttggatgagtgcttacggacat
cgcctgactttcgatgaacaaggttatgccacatgtccggaaagcaatgaaaagtatcat
ttatcggacggaaaagtccaaaaaataaacgcatga

DBGET integrated database retrieval system