KEGG   Candidatus Fluviicola riflensis: CHH17_03160Help
Entry
CHH17_03160       CDS       T05019                                 

Definition
(GenBank) hypothetical protein
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
flu  Candidatus Fluviicola riflensis
Pathway
flu00040  Pentose and glucuronate interconversions
flu00053  Ascorbate and aldarate metabolism
flu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:flu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CHH17_03160
   00053 Ascorbate and aldarate metabolism
    CHH17_03160
Enzymes [BR:flu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     CHH17_03160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASS47761
Position
751378..752937
Genome map
AA seq 519 aa AA seqDB search
MLTISGKNCIGYADSALGAQTFQAVNPVSDTVFGISFVQATDAEVDLAVSKATEAFQIWS
NEPLQNRVAFLKAIAVAVHSHSAELTRWYCEETGLPLSRAKTELERSCFQFESYAEAIAS
GFALSIRIEPSSGPGKPDLRKMNVPLGAVVVFGASNFPFAYSTLGGDVASALAAGCPVIV
KAHPMHPHTSELSARIILSVAREMGLPDGVFSHLHAIDYKVGEQLVLHPHIKAVGFTGSI
QGGTTLVRLANSRLVPIPVYAEMGSSNPMVFTTEVLAVRSESIAKEVAASISLSAGQFCT
SPGLLFMVDSDATKQFLSSLAALLQKTEPQIMLHPGIYKQYEQQASQHLEGSEILVNGLR
LNNEIQPSLVRISSRQLLREPGRAEEVFGSFATAVVCENESELLACLNALSGQLTASLYL
EPHENGAILMSALQRFAGRIIVNGVPTGVAVSAAMQHGGPFPSSSIPSSTAVGSDAIQRF
MRPVCFQNVTDDLLPNSLKIANPEGLLRFVNGLFTNAPC
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgttaacgattagtggcaaaaactgcataggttatgcagacagtgccttgggtgcgcaa
acatttcaagccgttaatccagtatccgataccgtattcggaatctcattcgttcaggca
actgatgctgaggttgatttggcagtttctaaagcaactgaagcttttcaaatctggtcg
aatgaaccgttacaaaaccgtgttgccttcctaaaagctattgcagtcgctgttcacagc
cattctgccgaattaacgcgttggtattgcgaagaaaccggtttgccgctttcgcgtgct
aagacagaactggaacgttcgtgtttccagtttgaatcgtatgctgaggcaattgccagc
ggttttgcattatcaattcgaatagaaccttcttcaggacccggaaaacccgatttacgt
aaaatgaacgtaccgttgggggcagttgtagtatttggcgccagtaatttcccgtttgcc
tattcaacgcttggcggcgatgtggcttccgcgcttgcggccggctgcccggttattgta
aaggcacatccgatgcatccgcatacaagcgaattatctgcacgtattattttgtcggtg
gcccgtgaaatgggattgcccgacggtgttttttcgcacttgcacgccattgattataaa
gtcggtgaacaattggtacttcatccgcatataaaagctgtcggtttcaccggaagtatt
cagggtggaacaacattggtacgtttggcaaacagtcgcctagttccgattcctgtttat
gcggagatgggcagttcgaacccaatggtgtttacaaccgaagtattggcggttcgcagt
gaatcgatcgcgaaggaagttgctgcttccattagtttaagcgccggacagttttgcaca
tcacccgggctattattcatggtcgattctgatgcgacaaaacaattcctgtcatcgctc
gctgcgttacttcaaaaaaccgaaccacagataatgttgcatcccggaatctacaaacaa
tacgagcaacaggcttctcaacacctggaaggatcggaaatactggtaaacggcttgcgc
ttaaacaatgaaattcaaccttcgctggtgagaatcagcagccgacaattgttgagagaa
ccaggcagggcagaagaagtgttcggatcgtttgcaacagcagttgtttgtgaaaacgaa
tcggaattgctggcctgtttgaatgcgctttctggtcagttaacggcttctttgtacctt
gaaccacatgaaaacggggcgattttgatgtcagcattgcagcgatttgcaggaagaatt
atcgtcaatggtgtgccaacaggagttgcagtatcagcggctatgcagcacggtggtcct
tttccaagttcgtcaattccatcttctacagcagttggttccgatgccatccagcggttt
atgcgaccggtttgcttccagaatgttacagacgacctgctaccgaattcgttaaaaatc
gctaatcctgaaggtcttttacggtttgttaacggtttattcaccaatgccccttgttga

DBGET integrated database retrieval system