KEGG   Candidatus Fluviicola riflensis: CHH17_07630Help
Entry
CHH17_07630       CDS       T05019                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
flu  Candidatus Fluviicola riflensis
Pathway
flu00540  Lipopolysaccharide biosynthesis
flu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:flu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CHH17_07630
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:flu01005]
    CHH17_07630
Enzymes [BR:flu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     CHH17_07630
Lipopolysaccharide biosynthesis proteins [BR:flu01005]
 Unusual sugar
  CHH17_07630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_3 Hydrolase HAD_2 RPN5_C
Motif
Other DBs
NCBI-ProteinID: ASS48606
Position
1839616..1840311
Genome map
AA seq 231 aa AA seqDB search
MQFLEQNIKGLCTKFGVDFNQFMADFQVDSVGELTMIDLEAFAEENEVDLYSLLYKPLFV
LDHLKPLLAKIKLLILDVDGVLTDAGMYYTESGDQVKKYNSKDGMAILEAQKQGLQIGII
SSAFVDKMVINRANTLRIKYVYVGREPKMDILNQWCTDLGLTLDQVAMIGDDINDLPIME
AVGFSCCPADAVQVVKHTVDVVLNLKGGKGCVRELIDNYLLEQPLGSSQKN
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttttagaacaaaatattaaaggattgtgcacgaagttcggcgtggatttcaac
cagtttatggctgattttcaggtagacagtgtgggtgaattaaccatgattgatctggaa
gcttttgccgaagaaaacgaagtggatttgtattccctgctctacaaaccgctgtttgtg
ctggatcatttgaaaccgcttttagccaaaatcaaattgctgattctggatgtagatggc
gtattgaccgatgcagggatgtattataccgaatcaggcgaccaggtcaaaaaatacaat
tccaaagacggaatggcgatccttgaggcccagaaacaaggacttcaaatcgggattatt
tcttctgcctttgtcgataaaatggttattaaccgagcgaacaccctaagaattaaatac
gtctatgttgggcgcgaacccaaaatggatattttgaaccaatggtgtaccgatttggga
ttaaccctcgatcaggtagcgatgataggtgatgacatcaatgaccttccgattatggaa
gccgttggtttcagttgctgtcctgcagatgcagtgcaagtggtaaaacataccgtggat
gtagtattgaacctcaaagggggaaagggctgtgttcgcgaattgatagataattattta
ttggaacaaccgttggggagttcacaaaaaaattag

DBGET integrated database retrieval system