KEGG   Candidatus Fluviicola riflensis: CHH17_14860Help
Entry
CHH17_14860       CDS       T05019                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
flu  Candidatus Fluviicola riflensis
Pathway
flu00051  Fructose and mannose metabolism
flu00520  Amino sugar and nucleotide sugar metabolism
flu01100  Metabolic pathways
flu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:flu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CHH17_14860
   00520 Amino sugar and nucleotide sugar metabolism
    CHH17_14860
Enzymes [BR:flu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     CHH17_14860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ASS49983
Position
complement(3447292..3448380)
Genome map
AA seq 362 aa AA seqDB search
MKDNYCVIMAGGIGSRFWPMSTVQRPKQFLDVLGIGKSLLRMTFERLLNIAPAENIYIVT
NAIYKDIVKEQLPELSYDQILTEPERKNTAPCITYAAAKIHAINPNATLVVAPSDHLILK
EEKFVDVIRIAIETANRNERLVTLGIKPTRPDTGYGYIEFVEDGDILPGQVKDVKHFTEK
PNRELAEIFVKSGNYYWNSGIFIWRSVTILHALEKFKPELHELFTAESYKYNTAEEQAYV
NHCFAACEDISIDFAVMENAKNVDVVLATFDWSDLGTWGSLYTHLEKDYNGNAVIGDNVH
MINSTNCIVNLPNDKLALIEGLDNHIVVESDNMLMILNKDDEQNLKKYLIPMEEASPKFF
PK
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaagataattattgcgttatcatggccggtggaatcggaagtcggttctggcccatg
tctaccgttcagcgaccgaaacaattcctggacgttttgggaatcggtaaatcgttactg
cgaatgacttttgagcgtttgctgaacattgctccggctgaaaatatttacattgtcacc
aacgctatctacaaagacattgtaaaggagcaattacccgaattgtcatacgatcagatt
cttactgaaccggaacgcaagaatacagctccgtgtattacttatgcggctgcgaaaatt
catgcgatcaacccaaatgcaacgctggtagttgcgccttctgatcatttgatcttaaaa
gaagaaaaatttgttgatgttattcgcattgcaattgaaacagccaataggaatgagcgt
ttggtaacgttggggatcaaaccgacacgacctgataccggttacggttacatcgaattt
gtggaggatggtgatattttgccaggccaggtgaaagatgtaaaacattttactgaaaaa
ccaaatcgtgaactggcggaaattttcgtgaagagcggaaattattattggaattcaggc
attttcatttggcgttcagtaactattctgcatgcgttggaaaaattcaaaccggaactg
catgaattgtttaccgctgaatcgtataaatacaacactgctgaagaacaagcttatgtg
aatcactgttttgcagcctgtgaagatatttccatcgattttgcagtgatggaaaatgcc
aagaacgtagatgtggtattagctacgttcgattggtccgatttgggaacgtggggaagt
ttgtacacgcacctcgaaaaggattacaatggaaatgcggtgatcggcgacaatgtgcac
atgatcaattccactaattgcatcgtgaatttacccaacgataaactggcgctgattgaa
ggattggataatcacattgtggttgaatcggataatatgctgatgatcctgaacaaagat
gacgaacaaaacctgaagaaatacctcattccgatggaagaggccagtccgaagtttttt
ccgaaataa

DBGET integrated database retrieval system