KEGG   Finegoldia magna: FMG_0320Help
Entry
FMG_0320          CDS       T00661                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fma  Finegoldia magna
Pathway
fma00260  Glycine, serine and threonine metabolism
fma00750  Vitamin B6 metabolism
fma01100  Metabolic pathways
fma01110  Biosynthesis of secondary metabolites
fma01120  Microbial metabolism in diverse environments
fma01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    FMG_0320
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    FMG_0320
Enzymes [BR:fma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     FMG_0320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N GHMP_kinases_N PALP GHMP_kinases_C S-AdoMet_synt_N
Motif
Other DBs
NCBI-ProteinID: BAG07738
UniProt: B0S3W4
Position
373189..375483
Genome map
AA seq 764 aa AA seqDB search
MRYLSTRNSNLKVSSREAILKGISEDGGLYVPESFPKFDILDHLDLSYTQLCHAILSLYL
TDFVSDELLEIIEKSYASFEQDICKVAYHKDYYLELYHGRTSAFKDFALCLLPNLMIYAK
KSLGINEKTLILTATSGDTGKAALEGFYNTENIDILVLYPTEGVSCIQKAQMDTTSSLNS
KVISIDGNFDDAQTAAKKIFNDKDIKEELKNQNICLSSANSINIGRLLPQIVYYFYAYQD
LVNNKKISAGDKISFCVPTGNFGDILAGYYAKEMGLPIEKLVIASNDNNVLTDFFTTGTY
DANRDLVKTISPSMDILVSSNLERLIYHKSSDEIVKQKMTELNESKIFTFEGDFHEFKCG
YATENETRNTIKEVFEDEGYLIDTHTAVAKNITDKLGLDKTVILSTASPYKFSSTVLSAL
GENISSDEFENIDLLYEKTGAKIPTEIKKLHSKKIIHKTKITKDKIEDEVLKFAKRGKRI
SVPATSANIGPGFDALGVALDLANTCEFKLTDDENTFEKNVESNLIYKSYKYTFDFYGEK
IVPVEFDLDTNIPMSRGLGSSAACIVMGIMAAFSVMGKNPDEKEILKIATQIEGHPDNVA
PAIFADAVASILKDDEVFVEKFEISDKFKFLAIISDFELSTQKAREVLPENYTKNDAVFN
ISRVSMLVLSLISGNEDNLKIALEDKIHEPYRLQLIPEIEKIDEIIENSDAIGHYLSGAG
STIMIILKSDDTTSESEIRNKLNKLSNSYEVMQLDIDKKGAFII
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgagatatttatcgacaagaaattctaatttaaaagtttcatcacgtgaagcaattctc
aaaggaatatcagaagatggcgggctttacgtgccagaatcttttccaaaatttgatata
ctagatcacttggatctttcgtatacacaactttgtcacgcaatcctatctctttatctg
acagattttgttagcgacgaattactagaaataatcgaaaaatcatacgcaagcttcgag
caagacatctgcaaagtagcttatcataaagattattatttggagctttaccatggaaga
acatctgcattcaaagatttcgcactttgtttgcttccaaatcttatgatttatgcgaaa
aaatctttgggaataaatgaaaagacgttgatattgacggcgacatctggagatacagga
aaagctgctctcgaaggattttacaacacagaaaatatcgacatcttggttttgtatccg
acagaaggagtaagctgtatccaaaaagcacaaatggatacgacatcatcgctcaactca
aaagtaatatcgattgatgggaattttgatgatgcacaaacggcggccaagaagattttt
aacgacaaagatataaaagaagaattgaaaaatcaaaatatttgtttgtcatcagcaaac
tccattaatattggaagattgttgccgcaaatcgtctactacttctacgcataccaagat
ttggtaaataacaaaaaaatttctgccggagacaaaatatcattctgtgtacctacagga
aattttggagatatcttggctggatactacgcaaaagaaatggggcttccaattgaaaaa
ctcgtcatcgcatccaatgacaacaacgtgttgacagattttttcacgactggaacttac
gatgcaaacagagatttggtcaagacaatctctccttcgatggatattttggtttcatca
aatcttgaaagattgatttaccacaaatcatcagatgaaatcgtaaaacaaaagatgaca
gaattgaatgagtcgaaaattttcacatttgaaggagatttccatgagtttaaatgtgga
tatgcaactgaaaatgaaacgagaaatactatcaaggaagttttcgaagacgaagggtat
ttgatagacactcacactgcggttgcaaaaaatattacagacaaacttggcctcgataaa
acagttatattgtcgactgcaagcccgtacaaattctcttccacggttttgagtgcattg
ggagaaaatatctcgtcagatgaatttgaaaatattgatcttctatacgagaaaactgga
gcgaaaattcctactgaaatcaaaaaattacattccaagaagataattcataaaacaaaa
attacaaaagataaaatagaagatgaagtattaaaatttgcaaagcgaggcaagagaatt
tccgttcccgcaacgtctgcaaacattggccctgggtttgatgcacttggggttgcgctg
gatttggcaaacacatgtgaatttaagttgacagatgatgaaaatacatttgaaaaaaat
gtagaatctaatttgatatataaatcatacaagtatacatttgatttttacggagaaaaa
atagttcctgtggaatttgacctcgatactaatattccaatgtcacgaggactcggatcg
tctgcagcttgtatcgtaatgggaataatggcggcattttcagtcatgggaaaaaatcct
gacgaaaaagaaatattgaaaatagcaactcaaatcgaaggccatcccgacaacgtcgca
ccagcgattttcgcagatgcagttgcgtcaatattaaaagacgatgaagtttttgtggaa
aaatttgaaatatcagacaaatttaaattcctagcgataatttcagattttgagctttca
acacaaaaagcaagagaagtactgccggaaaattatacaaaaaacgatgcggtgttcaat
atttcgagagtttcgatgctagtattgtcattaatttctggaaatgaggataatctgaaa
atcgcacttgaagataaaattcacgagccttacagattacaactaattcctgaaatagag
aaaatcgacgaaattatcgaaaactctgatgcaatcggacattatttgagtggagcaggc
tcaacgattatgataattttaaaatcagatgacactacatcagaatcagaaattagaaat
aaactgaacaaattatccaattcttatgaagttatgcagcttgatatcgacaaaaaaggc
gcgtttataatttaa

DBGET integrated database retrieval system