KEGG   Finegoldia magna: FMG_0461Help
Entry
FMG_0461          CDS       T00661                                 

Definition
(GenBank) formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
fma  Finegoldia magna
Pathway
fma00670  One carbon pool by folate
fma01100  Metabolic pathways
fma01120  Microbial metabolism in diverse environments
fma01200  Carbon metabolism
Module
fma_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:fma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    FMG_0461
Enzymes [BR:fma01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     FMG_0461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Peptidase_S66
Motif
Other DBs
NCBI-ProteinID: BAG07879
UniProt: B0S0G1
Position
517660..519324
Genome map
AA seq 554 aa AA seqDB search
MFMATDVEIAQKAKLEKISVIAEKMGLTEEDYEQYGRYKAKLDLNLFEKNKDKKDGKLIL
MTSINPTPTGEGKTTMNVGLAMGLNKIGKNAISVLREPSLGPNFGMKGGAAGGGYAQVVP
MDEINMHFTGDFHAITTANNLICAMMDNHIHQGNALNIDPKQILIKRCMDMNERELRDII
IGVGAKGNGVMRQDGFEITVASEIMAILCLAKDLKDLKERVGNILIAFDKEGKPVYARDV
KADGAVALVMKEAIKPNLVQTLEHTPAIIHGGPFANIAHGCNSLIATKLGLKLGDYVVTE
AGFGADLGAEKFFDIKCRNDLHPNMVCIVATIKALKHHGEAEDFKVENVEALEKGYANLK
RHIENMKKYKVPVVVAINRFATDTDAEIKKLTELVEADGTRAIFCDVWAKGGEGAKELAE
YVVENTKEENDFEFLYDLELPIKEKIEKIAKEIYRADGVEFSAKAKKKLKQIKELGLDNY
PVCMAKTQYSFSDNKKLIGAPTGFTITVSDFKISRGAGFVVALLGSVMTMPGLPKVPSAE
NCDVLDDGTVVGLF
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtttatggctacagatgtagaaattgctcaaaaagcgaaattagaaaaaatcagcgtg
attgctgaaaaaatgggattaacagaagaagattatgaacaatatggtagatataaggca
aaattagatttaaatctttttgaaaaaaataaagataaaaaagatggtaaattaattttg
atgacaagtattaaccctacaccaactggagaaggtaaaacaactatgaatgttggtttg
gcaatgggacttaacaaaattggcaaaaacgctatctcagtattaagagaaccatcttta
ggaccaaactttggtatgaaaggtggagctgcgggtggtggatatgcacaagtagttcca
atggacgaaatcaacatgcacttcactggtgacttccatgcaatcactactgcaaacaac
ttgatttgcgctatgatggacaaccacattcaccaaggtaatgcgttaaacatcgatcca
aaacaaatcttaattaaaagatgtatggatatgaacgaacgtgaattaagagatataatt
atcggagttggcgcaaaaggtaacggagttatgcgtcaagatggtttcgaaattactgtt
gcaagtgaaatcatggctattttatgtcttgcaaaagatttgaaagacttaaaagaaaga
gttggaaatattctaatcgctttcgataaagaaggtaaaccagtttatgcaagagacgtt
aaagctgatggtgcagtagcattagttatgaaagaagctatcaaaccaaacttagttcaa
acattagaacacactccagcaattattcacggtggaccattcgctaacattgcacatggt
tgtaactctttaatagctactaaattaggattgaaacttggagattacgttgttacagaa
gcaggtttcggtgctgacttaggagcagaaaaattcttcgatattaaatgtagaaatgat
ttacatccaaacatggtatgtatcgtagctacaataaaagcattaaaacatcacggggaa
gcagaagatttcaaagttgaaaatgtagaagctttggaaaaaggatatgctaaccttaaa
cgtcatattgaaaatatgaagaaatacaaagttccagtagtagtagcaatcaatagattt
gcaactgatacagatgcagaaattaagaaattaactgaattagttgaagcagatggaaca
agagctattttctgtgatgtatgggctaaaggtggagaaggagctaaagaattagcagaa
tatgttgttgaaaatacaaaagaagaaaacgacttcgaattcttatatgaccttgaatta
cctatcaaagaaaaaatcgaaaaaattgcaaaagaaatttacagagcagacggcgtagaa
ttcagtgcaaaagctaagaaaaaattaaaacaaatcaaagaattaggattagacaattat
ccagtatgtatggctaagactcaatactcattctctgataataaaaaattaatcggagct
ccaactggatttacaatcacagtaagtgatttcaaaatctcaagaggtgccggatttgtt
gttgcattattaggatctgtaatgacaatgccaggtttaccaaaagtaccttcagcagaa
aattgcgatgttttagatgatggtacagttgtaggattattctag

DBGET integrated database retrieval system