KEGG   Finegoldia magna: FMG_1002Help
Entry
FMG_1002          CDS       T00661                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fma  Finegoldia magna
Pathway
fma00010  Glycolysis / Gluconeogenesis
fma00030  Pentose phosphate pathway
fma00051  Fructose and mannose metabolism
fma00052  Galactose metabolism
fma00680  Methane metabolism
fma01100  Metabolic pathways
fma01110  Biosynthesis of secondary metabolites
fma01120  Microbial metabolism in diverse environments
fma01130  Biosynthesis of antibiotics
fma01200  Carbon metabolism
fma01230  Biosynthesis of amino acids
fma03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fma00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FMG_1002
   00030 Pentose phosphate pathway
    FMG_1002
   00051 Fructose and mannose metabolism
    FMG_1002
   00052 Galactose metabolism
    FMG_1002
  Energy metabolism
   00680 Methane metabolism
    FMG_1002
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    FMG_1002
Enzymes [BR:fma01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     FMG_1002
Protein phosphatases and associated proteins [BR:fma01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     FMG_1002
Messenger RNA biogenesis [BR:fma03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     FMG_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Baculo_DNA_bind
Motif
Other DBs
NCBI-ProteinID: BAG08420
UniProt: B0S230
Position
complement(1086044..1087003)
Genome map
AA seq 319 aa AA seqDB search
MKTIAILTSGGDAPGMNACIRSIARTCIYNGIRVMGIRSGYDGLMNGNIYEMNVSSVADI
IHRGGTILGSARCPEFKTEEGQKKGAQILKDFGIDGLVVLGGDGSFKGASALSKIGISTI
GIPCTIDNDMGYTDYTIGFFTAVETVSDAISKLRDTSSSHGRANIIEVMGRNCGDIALYS
GVASGAESILVPEVELNIDEVTEKIERGRKRGKLHHLIMLAEGVGGAYDIKNMIEEKTGV
ETKVTILGHVQRGGTPCTFDRLMATQMGNLAVKLIMEEKTDLAIAMKDNKIITVPIDEAV
TTKRKFRDDLYEISKEISI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaatagcaattctaacaagtggtggcgatgcaccaggaatgaatgcatgcatt
cgttctatagctagaacttgtatttacaatggtataagagttatgggaataaggtctgga
tatgatgggcttatgaacggaaatatttacgaaatgaatgtttcttctgttgcagatatt
attcaccgtggcggaactatcttgggatctgcgagatgcccggaattcaaaaccgaagaa
ggtcaaaaaaagggtgcacaaattttaaaagattttggaatagatggacttgtggtttta
ggtggagatggttcatttaaaggtgcaagtgcacttagcaaaataggaatatcgactatt
gggattccttgtacaatagataatgatatgggttataccgattatacgattggatttttc
actgctgttgagacagtaagtgatgcgatatcaaaattaagagacacttcttcaagccat
ggacgagcgaacataattgaagttatgggaagaaattgcggagatatcgcattgtattca
ggagttgcatcgggagcggaatctattctcgttcctgaagtagaattaaatatagatgag
gttacagaaaaaatcgaacgaggaagaaaaagaggaaaacttcatcatttaattatgctt
gctgaaggagtcggtggagcatatgatattaaaaatatgattgaagaaaaaactggagta
gaaacaaaagttacaattttgggtcacgttcaacgtggtggaactccatgtacatttgat
aggttaatggcaacacaaatgggaaatttggcagtaaaattaataatggaagaaaaaaca
gacttggctatcgccatgaaagataataagataatcacagtcccaattgatgaggcagtt
acaacaaaaagaaaatttagagatgatttgtatgaaatatccaaagaaatctcaatataa

DBGET integrated database retrieval system