KEGG   Finegoldia magna: FMG_1428
Entry
FMG_1428          CDS       T00661                                 

Definition
(GenBank) thiamine biosynthesis protein
  KO
K03147  phosphomethylpyrimidine synthase [EC:4.1.99.17]
Organism
fma  Finegoldia magna
Pathway
fma00730  Thiamine metabolism
fma01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fma00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FMG_1428
Enzymes [BR:fma01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.17  phosphomethylpyrimidine synthase
     FMG_1428
SSDB
Motif
Pfam: ThiC_Rad_SAM
Other DBs
NCBI-ProteinID: BAG08846
UniProt: B0S3A6
Position
complement(1576983..1578284)
AA seq 433 aa
MEYTTQLDAAKKKIITKEMKRVAQKENIDVEILREKIEKGYVVIPANKNHKSLDAHGVGE
GLKTKINVNLGISKDCYNIEKEMEKVRVAIDMDAEAIMDLSNYGKTRKFREELIGYSPAM
IGSVPMYDCVGMLDKELKDITEEEFLEVVEQHAKDGVDFITIHVGLTRDIAQHLKTTDRI
TKIVSRGGSLLFAWMIVNNKENPLVTRYDDILEICEKYDVTLSLGDALRPGCINDATDDL
QIQELINLSRMAKRAYEKNVQVMIEGPGHVPIDQIEANMKIEKTICNNAPFYVLGPLVTD
IAPGYDHITSAIGGAIAASTGADFLCYVTPAEHLRLPNLEDMKEGIIATKIAAHAGDIAK
KIPGAKERDDEMSRARFNLDWEKMFELAIDSEKPKKYRKESQPIEEDSCTMCGKMCSMRT
VKKVLNGEDVNLI
NT seq 1302 nt   +upstreamnt  +downstreamnt
atggaatatacaactcaattagacgctgcgaagaagaaaatcattacaaaagaaatgaaa
agagtagcgcaaaaagaaaatatagacgtagaaattcttagagaaaaaattgaaaaagga
tacgtggttattcctgcaaacaaaaaccacaaatcactagatgcacacggtgtcggcgaa
ggtttgaaaacaaaaattaacgtgaatttgggtatttcaaaagactgctacaacatcgaa
aaagaaatggaaaaagttagagtggcaatcgacatggatgcagaagcgataatggatttg
tcaaattacggtaagacaagaaaatttagagaagaacttatcggttactctccagcaatg
attggtagcgttccaatgtacgattgtgtgggaatgttggataaagaattgaaggatatt
actgaagaagaattcttggaagttgtggaacaacacgcaaaagacggggtggatttcatc
acaattcacgttggacttacaagagatatcgcacaacatttgaaaacaacagatagaatc
acaaaaattgtgtcacgtggtggatcattattattcgcgtggatgattgtgaacaacaaa
gaaaacccacttgtaacaagatacgacgatatacttgaaatctgcgaaaaatacgacgtg
acactaagcttgggagatgcattgagaccaggttgcatcaacgatgcgacagatgatttg
caaattcaagagctaatcaatctatccagaatggcaaaaagagcctacgaaaaaaatgtc
caagtaatgattgaaggaccaggccatgttccaatcgatcaaatcgaagcaaacatgaaa
atcgaaaaaacaatctgtaacaacgctccattttatgtgttgggacctttggttactgac
attgctccaggatacgatcacataacatcagcaatcggtggtgccattgcagcaagtacg
ggagcagatttcttgtgttacgtaactcctgcagaacatttgagactacctaacttggaa
gatatgaaagaaggaatcattgctacgaaaattgcagctcatgctggagatatagcgaag
aaaatccctggagcaaaagaaagagacgacgaaatgagtagagctcgcttcaacttagat
tgggaaaaaatgttcgaacttgcaattgacagcgagaaaccaaaaaaatacagaaaagaa
tctcaaccaatcgaagaagatagctgcacaatgtgcggaaaaatgtgttcaatgagaaca
gtgaagaaagtattgaacggcgaagatgtcaatttaatttag

DBGET integrated database retrieval system