KEGG   Fomitiporia mediterranea: FOMMEDRAFT_108781Help
Entry
FOMMEDRAFT_108781 CDS       T03132                                 

Definition
(RefSeq) 2-phosphoglycolate phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
fme  Fomitiporia mediterranea
Brite
Enzymes [BR:fme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     FOMMEDRAFT_108781
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase DUF5475
Motif
Other DBs
NCBI-GeneID: 18670372
NCBI-ProteinID: XP_007267233
JGI: Fomme1_108781
Position
Unknown
AA seq 306 aa AA seqDB search
MSNPLRLSSPQEYTKLLEKFDTWLFDCDGVLWRGNTLIEGALEFLQLLRSKKKSVIFVTN
NATNSRASYKKKFDKLGIEAHVDEIFGSAYAAAVYLSTVIKFPRDKKVFVIGMSGLEEEL
RDEGVAYVGGTDAESNTLEPFVPTSYVPDPSIGAVLCGLDMSINYTKLSKAFIQLNTDPS
CLFLATNEDSTYPAQGGVLLPGAGAINAPLRFALGRDPLSLGKPSQIMLDCIKAKHDFDP
ERTIMVGDRLNTDILFGKQGGVSTLLVLTGISKETDLLPGASPPAIPDYVTNSISDLMHA
ESVLSA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccctcttcgacttagttcgccacaagaatacacaaagctactggaaaagttc
gacacatggctgtttgactgtgatggggttctctggcgtggcaacactctcatagaaggc
gcccttgagtttctccagcttttacgttccaaaaagaaaagtgtcatatttgtgacaaat
aacgcaacaaactcgcgtgccagttacaagaagaaatttgacaagctcggtatcgaagct
catgttgacgagatctttggctcagcgtatgctgcagcagtctatttatcgacagtgatt
aaattcccgagggacaagaaggtctttgtcattggaatgagtggtcttgaagaagagctg
cgagacgaaggggtcgcttacgtcggtggaacagatgctgagagtaacacccttgaacca
ttcgttcctacgtcctacgtaccggatccgtccataggtgccgtactctgcggcctagac
atgtcgattaattacacaaagctcagcaaggcattcattcaattgaacaccgatccgtct
tgcttattcctcgctacgaacgaggactcgacgtacccggcacaaggtggcgtgctactt
ccgggtgcgggcgcgattaacgcaccgttacgtttcgctcttggaagagaccctctgagc
cttggaaagccgtcgcagattatgcttgattgtatcaaagcgaaacacgacttcgatcct
gaacgaacaataatggttggcgatcgtctcaacaccgatattctcttcgggaagcagggt
ggcgtatctactcttcttgtcctcacaggcatatcgaaagagaccgacctattaccgggg
gcgtcacctcctgcaattcccgattacgtaacgaattctatcagcgacctgatgcatgct
gagagtgtattgagtgcatga

DBGET integrated database retrieval system