KEGG   Fomitiporia mediterranea: FOMMEDRAFT_112192Help
Entry
FOMMEDRAFT_112192 CDS       T03132                                 

Definition
(RefSeq) glycogen synthase
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00500  Starch and sucrose metabolism
fme01100  Metabolic pathways
Module
fme_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOMMEDRAFT_112192
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:fme01003]
    FOMMEDRAFT_112192
Enzymes [BR:fme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     FOMMEDRAFT_112192
Glycosyltransferases [BR:fme01003]
 Polysaccharide
  Storage polysaccharide
   FOMMEDRAFT_112192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_5 Glyco_trans_4_4 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 18670638
NCBI-ProteinID: XP_007269420
JGI: Fomme1_112192
Position
Unknown
AA seq 735 aa AA seqDB search
MSAAVEKRDIKQPLLFECAWEVANKVGGIYTVIKTKVPVTVSEFGDRYCLIGPLSYKTAP
MEVDAQEPEDEHLKAAIESMRLKGIKILYGRWLIEGAPRVMLFDTGSAYHFLDEWKGDLW
NLAGIPTPPNDHETNETIVFGYLVSWFLGEYVSHQLEHAVIAHFHEWQAGLAIPLCRKRH
IDVTTVFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSAAHCADVF
TTVSHITAYEAEHLLKRKPDGVVPNGLNVVKFQAMHEFQNLHAQSKAKINDFIRGHFYGH
YDFDIDNTLYMFTAGRYEYRNKGVDMFIESLARLNYRLQKSGSTLTVVAFIIMPAATQSY
TVEALKGQAVIKQLRDTVSDIQTRIGERIFEHAARYTGESGTEFPLIDSLLSEQDKVLLK
RRIFALKRNSLPPVTTHNMADDAHDPILNQVRRVQLFNGHNDRVKIIFHPDFLNSNNPIL
GLDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGSFMQDLIEEPADEG
CYIVDRRMKSIEESVNQLTDCMFSFCNKTRRQRINQRNRVERLSPLLDWKNLGIEYSKAR
QLALRRAYPDSFSDEDEEYDFAAGVERLPFSMPGSPRLRAGMATPGDMGTLTEEMQGLST
SDYRGTMWPGKEEEEEGYPFPLVMKVRSRASSIRSGASTPGGGAYKSLSERDLQKADAAL
SHVNENQEVKVNGAY
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctgccgtcgaaaaacgcgacataaagcagcctttactcttcgaatgcgcatgg
gaggtcgccaataaagtcggtggtatctacaccgttatcaaaacaaaggtccccgtcacc
gtttccgagttcggcgaccgttattgcctcatcggtccactcagctacaaaacggctccg
atggaggttgatgcacaggaacctgaggatgaacacttgaaagctgcgattgagtcgatg
cgcttgaaaggtatcaagattctgtacggaagatggctaatcgaaggtgccccgcgcgtc
atgttgttcgatacgggcagcgcgtatcattttcttgatgagtggaagggtgatctatgg
aacttggcgggcatcccgactccaccgaatgatcatgaaacgaacgagactatcgtcttt
ggttatctcgtttcttggttccttggcgagtatgtttctcatcagctcgagcacgctgtt
atcgcgcatttccacgagtggcaagccggcttggcaatcccgctatgtcggaaaaggcac
atcgatgtgactactgtgttcacgacccatgctacgctacttgggcggtacctctgcgcg
ggtagtgttgacttttacaacaacctgcaatatttcgatgtcgatcatgaagctggcaag
cgtggtatttaccatcgctactgcatagaacgctccgcggcacattgtgcagatgtgttc
acgaccgtatcgcatatcaccgcgtacgaggccgagcaccttctcaagcgtaaaccggac
ggagtcgtgccgaatggactcaacgtcgtgaagttccaagcgatgcacgaattccagaac
ctccatgcgcagtcgaaggcgaagatcaacgacttcattcgcggtcacttctatggccac
tacgacttcgatattgataacactctgtacatgtttacggctgggcggtacgagtaccgt
aacaagggtgtcgatatgttcattgaatcgctagcgcgtctgaattatcgactacaaaaa
tcgggctcgactttaacggtcgttgcattcattattatgcctgccgcgacccaatcatat
acagtggaggctctcaagggccaggctgtcattaaacaacttcgggataccgtctccgac
atccagactcgcataggtgaacgtatatttgaacatgcggcgcgctacacgggtgaatcc
ggtacggagttcccgttaatagacagccttctctcggagcaagacaaggtgctgttgaaa
cggcgaatcttcgctctcaaacgcaattcattgccacctgtcacaactcacaacatggcg
gacgacgcgcacgacccaatcctcaatcaagttcgtcgtgttcagttattcaacggacac
aacgaccgcgtcaaaattattttccacccggatttcctcaactcgaacaacccgattctt
ggtttggattatgaggagttcgtcaggggctgccatctcggcgtctttccgagttactac
gagccgtggggatacaccccagcagaatgtacagttatgggtgtaccgtctattacgaca
aatctctccggatttggctcgttcatgcaagatctaatcgaggaacctgcagatgagggg
tgctacatcgttgataggaggatgaagtcaatcgaagaatccgttaaccaactaacggac
tgcatgttctcgttctgcaacaagacacggagacagcggattaatcagcggaatcgcgtt
gagaggctttcgccgttgttggattggaagaatctggggattgagtattcgaaagcgagg
cagttggcgctgagacgtgcatatccggattcgtttagtgatgaggatgaggagtatgat
tttgctgctggggtggagaggctgccgttttcgatgccgggaagtccgaggttacgtgcg
ggtatggcgacacctggggatatgggtactttgacggaagagatgcaaggattgagtacg
agcgattatcgtggaactatgtggccagggaaggaggaagaagaggaaggctatcctttc
ccgttggtgatgaaagtccgttcacgcgcaagttccatccgatccggtgcgagtacacca
ggtggcggcgcatacaagagcctgagcgagagagacttacagaaggcagacgcagcgctg
agccatgtaaacgagaaccaagaggtgaaggtgaacggggcatactaa

DBGET integrated database retrieval system