KEGG   Fomitiporia mediterranea: FOMMEDRAFT_124771Help
Entry
FOMMEDRAFT_124771 CDS       T03132                                 

Definition
(RefSeq) heat shock protein HSS1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
fme  Fomitiporia mediterranea
Pathway
fme03040  Spliceosome
fme04141  Protein processing in endoplasmic reticulum
fme04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fme00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    FOMMEDRAFT_124771
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    FOMMEDRAFT_124771
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    FOMMEDRAFT_124771
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fme01009]
    FOMMEDRAFT_124771
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:fme03041]
    FOMMEDRAFT_124771
   03009 Ribosome biogenesis [BR:fme03009]
    FOMMEDRAFT_124771
   03110 Chaperones and folding catalysts [BR:fme03110]
    FOMMEDRAFT_124771
   04131 Membrane trafficking [BR:fme04131]
    FOMMEDRAFT_124771
   03051 Proteasome [BR:fme03051]
    FOMMEDRAFT_124771
   03029 Mitochondrial biogenesis [BR:fme03029]
    FOMMEDRAFT_124771
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fme04147]
    FOMMEDRAFT_124771
Protein phosphatases and associated proteins [BR:fme01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     FOMMEDRAFT_124771
Spliceosome [BR:fme03041]
 Complex B
  Other components
   Prp19 complex
    FOMMEDRAFT_124771
 Complex C
   Prp19-CDC5 complex
    FOMMEDRAFT_124771
Ribosome biogenesis [BR:fme03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    FOMMEDRAFT_124771
Chaperones and folding catalysts [BR:fme03110]
 Heat shock proteins
  HSP70 / DNAK
   FOMMEDRAFT_124771
Membrane trafficking [BR:fme04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    FOMMEDRAFT_124771
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    FOMMEDRAFT_124771
Proteasome [BR:fme03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    FOMMEDRAFT_124771
Mitochondrial biogenesis [BR:fme03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    FOMMEDRAFT_124771
Exosome [BR:fme04147]
 Exosomal proteins
  Proteins found in most exosomes
   FOMMEDRAFT_124771
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A StbA
Motif
Other DBs
NCBI-GeneID: 18671327
NCBI-ProteinID: XP_007267789
JGI: Fomme1_124771
Position
Unknown
AA seq 670 aa AA seqDB search
MSSSKAIGIDLGTTYSCVGIWQHDRVEIIANDQGNRTTPSYVSFSDTERLIGDAAKNQIA
MNPTNTVFDAKRLIGRRFEDAEVQADMKHFPFKVINKDGKPIVQVEYRGETKTFTPEEIS
SMVLTKMKETAESYLGTTVTEAVITVPAYFNDSQRQATKDAGVISGLQVLRIINEPTAAA
IAYGLDKKVQGERNVLIFDLGGGTFDVSLLTIEEGIFEVKATAGDTHLGGEDFDNRLVNH
FVQEFKRKHKKDLSTNARALRRLRTACERAKRTLSSAAQTTIEIDSLFEGIDFYTSLTRA
RFEELCNDLFRSTLEPVEKVLRDSKIDKSNVHEIVLVGGSTRIPRIIKLVSDFFNGKEPN
KSINPDEAVAYGAAVQAAILKGDTSEKTQDLLLLDVAPLSLGIETAGGVMTALIKRNTTV
PTKKTEVFSTYADNQPGVLIQVYEGERARTKDNNLLGKFELSGIPPAPRGVPQIEVTFDI
DANGILNVSAAEKTTGKSNRITITNDKGRLSKEEIERMLQEAEKFKAEDEAEAARISAKN
GLESYAYNLRNTLSDDNVKPKLEKLDQANLSKLQTSINETISWLDANQQATKDEYESRQK
ELQEDANKVMRELYGDAGGGGAFPGGPGGAGGFPGAGGAGGFPGGAPGGFPGAGGPAGGA
DDGPSVEEVD
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcttcaaaagctatcggtattgatctcggaacgacttactcctgtgtcggtatt
tggcaacatgatcgtgtcgagattattgccaacgaccagggtaatcggacaacgccctcc
tatgtgtcgttctctgacacagaacgtctcatcggcgatgccgcgaagaaccaaattgcc
atgaacccgaccaacaccgtcttcgacgccaagcgtctcattgggcgtcgattcgaggat
gctgaggtccaggccgatatgaagcatttccctttcaaggtgatcaacaaggatggtaaa
cctatcgtccaagtcgagtaccgcggcgagactaagaccttcactccggaggaaatctcc
tctatggtccttacaaagatgaaggaaaccgctgaatcgtatctcggaacgacagtgacg
gaagccgtcatcaccgtccccgcatacttcaacgactcgcaacgtcaggcaaccaaggat
gccggtgtcatctctggtcttcaagtcctccgtatcatcaatgagccaactgcagcagct
attgcttacggtctggacaagaaggtccagggcgagcggaatgtccttatcttcgacctt
ggtggaggtaccttcgatgtatctctcttgaccattgaggagggtatcttcgaagtcaag
gccaccgccggtgacacccacttgggtggtgaggactttgacaaccgtctcgtcaaccac
ttcgtgcaagaattcaagaggaagcacaagaaggatctttccacaaatgcacgtgcactc
cgacgactccgaacggcttgcgagcgtgctaaacgcactctctcgtctgccgctcagacg
accattgaaatcgactcgctcttcgagggtattgacttctacacctcgctcactcgtgca
cgtttcgaggaattgtgcaatgacctcttccgttcaactctcgagcccgttgagaaggtg
cttcgtgactccaagattgacaagtcaaacgtacacgagatcgtccttgttggtggttcg
acccgtattcctcggatcatcaagctcgtctccgacttcttcaatggcaaggagcccaac
aagtcaatcaacccggatgaggccgttgcgtacggagctgccgtacaagctgccatcctc
aagggtgacacttcggagaagactcaggaccttttgttgctcgacgttgcaccgttgtcg
ctcggtatcgagactgctggtggtgtcatgactgcactcatcaagcgtaacacgaccgtc
ccgacgaagaagaccgaggtcttctcgacgtacgctgacaaccagcctggtgtactcatt
caagtgtacgagggtgagcgtgcacgtacaaaggacaacaacctacttggcaagttcgag
ctgtctggtatcccgcctgcaccacgtggagttccgcaaatcgaagtcacattcgacatt
gacgcgaacggtattctcaacgtctcggcggccgagaagacaactggtaaatcgaaccgc
atcacgatcacgaacgacaagggtcgtctatctaaggaggagattgagcggatgctccag
gaggccgagaagttcaaggctgaagacgaggctgaggctgctcgtattagtgcgaagaac
ggccttgagtcatatgcctacaacttgcgcaacactctgtccgacgacaacgtgaagccc
aagctcgagaagctggaccaggcgaacttgagcaagctgcagacatcgatcaacgagaca
atcagctggctcgacgcgaaccagcaggcgacgaaggatgagtacgagtcacggcagaag
gagctgcaagaggatgccaacaaggtcatgcgtgagctgtacggggacgctggaggagga
ggtgcgttccctggcggtcctggcggtgccggaggcttccctggtgctggtggtgctggt
ggcttccccggtggagcacctggaggcttcccaggcgcaggcggtcctgctggcggggca
gacgacggccccagtgtcgaggaggttgactaa

DBGET integrated database retrieval system