KEGG   Fomitiporia mediterranea: FOMMEDRAFT_136243Help
Entry
FOMMEDRAFT_136243 CDS       T03132                                 

Definition
(RefSeq) hypothetical protein
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
fme  Fomitiporia mediterranea
Pathway
fme00500  Starch and sucrose metabolism
fme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FOMMEDRAFT_136243
Enzymes [BR:fme01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     FOMMEDRAFT_136243
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 18672039
NCBI-ProteinID: XP_007269625
JGI: Fomme1_136243
Position
Unknown
AA seq 455 aa AA seqDB search
MFRAGSLLFALLAVVHGQQVGTLTAENHPSLSVQQCSQGGSCSTQSRSVVLDSNWRWLHQ
VGTSTNCYTGNTWDTSLCPDAVTCAQNCALDGADYSGTYGITTSGNALTLKFVTQGPYSK
NIGSRVYLMADQSNYQMFKLKNQEFTFDVDMSNLPCGLNGALYFVEMDQDGGLSRFSGNK
AGAKYGTGYCDTQCPHDIKFINGEANVEGWAPSPNDVNAGSGQYGTCCVEMDVWEANSMA
AAVTPHACTIQGQTRCSGTQCGDGDQRYDGICDKDGCDFNSFRMGDKSFLGPGLEVDTRQ
KMTVVTQFVTADNTTSGRLSEIRRLYVQNGRVIQNSKVNIPGMEAYDSITDDFCNAQKRT
FGDNNSFESMGGLNTMGEAFDHGMVLVMSVWDDHAVNMLWLDSNYPTDAPATQPGIARGN
CPTSSGQPTQVESQSPGSSVTFSNIKFGPIGSTFA
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttccgcgctggttctttgctcttcgctctcctcgccgtcgtacacggtcagcaagtc
ggtacactgactgctgaaaaccatccgtctctgtctgttcaacaatgttctcaaggcggt
agttgctcgacgcagtccaggtcggttgtccttgactcgaactggcgttggttgcaccaa
gtcggtacctcgacgaactgctacactggtaacacctgggatacatctctgtgccccgac
gctgtaacttgcgctcagaactgtgcacttgacggtgccgactactcaggaacgtatggt
atcacgacgtctggcaatgcgctcacgctcaagttcgttacgcaaggaccatactcgaag
aacatcggttcacgagtgtacctgatggccgaccagagcaactaccaaatgttcaaattg
aagaaccaggagttcacgttcgacgttgacatgtctaaccttccttgtggtttgaacggg
gcactgtacttcgtcgaaatggaccaggacggtggcttgtcgcgattctcaggcaacaag
gctggcgcgaagtacgggactggttactgtgacacgcaatgtccgcacgacattaagttc
attaatggcgaggctaacgtcgagggatgggcgccatcgcctaatgacgtgaacgcagga
tcgggccagtacggtacatgctgcgttgagatggacgtctgggaggcgaactcaatggct
gccgccgtgacgccgcatgcctgcaccatccagggtcagactcgctgctcgggtactcaa
tgcggtgacggtgaccagcgctacgatggcatctgcgataaggatggttgcgactttaac
tccttccgtatgggtgacaagtccttcctcggcccaggtctcgaggtcgacacgcgccag
aagatgaccgtagtgactcagttcgtcactgctgacaacactacgtccggtaggctcagc
gagatccgccgcttgtacgttcagaacggtcgagtcatccagaactccaaggttaacatc
ccaggaatggaagcctacgactcgatcaccgatgacttctgcaatgcccagaagcggaca
ttcggcgacaacaactcattcgagtcgatgggcggacttaacacgatgggcgaagccttc
gaccatggcatggttctcgtcatgagtgtttgggacgaccacgctgttaacatgctctgg
ctcgacagcaactacccgactgacgcacctgcgacccagcctggtatcgcccgtggaaac
tgcccaacgtcctcaggtcagcctactcaggttgaatcccagagcccaggctcgtctgtt
accttctccaacatcaagttcggccctattggctccacctttgcctag

DBGET integrated database retrieval system